Dendrotoxin-K | Alomone Labs D-400 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Dendrotoxin-K

catalog :

D-400

more info or order :

Alomone Labs product webpage

citations: 26

Reference
Chou S, Li K, Huang M, Chen C, Lin King Y, Li G, et al. Kv1.1 channels regulate early postnatal neurogenesis in mouse hippocampus via the TrkB signaling pathway. elife. 2021;10: pubmed publisher
Ritzau Jost A, Tsintsadze T, Krueger M, Ader J, Bechmann I, Eilers J, et al. Large, Stable Spikes Exhibit Differential Broadening in Excitatory and Inhibitory Neocortical Boutons. Cell Rep. 2021;34:108612 pubmed publisher
Cho I, Panzera L, Chin M, Alpizar S, Olveda G, Hill R, et al. The potassium channel subunit Kvβ1 serves as a major control point for synaptic facilitation. Proc Natl Acad Sci U S A. 2020;117:29937-29947 pubmed publisher
Feria Pliego J, Pedroarena C. Kv1 potassium channels control action potential firing of putative GABAergic deep cerebellar nuclear neurons. Sci Rep. 2020;10:6954 pubmed publisher
Zurita H, Feyen P, Apicella A. Layer 5 Callosal Parvalbumin-Expressing Neurons: A Distinct Functional Group of GABAergic Neurons. Front Cell Neurosci. 2018;12:53 pubmed publisher
Browne L, Smith K, Jagger D. Identification of Persistent and Resurgent Sodium Currents in Spiral Ganglion Neurons Cultured from the Mouse Cochlea. Eneuro. 2017;4: pubmed publisher
Vivekananda U, Novak P, Bello O, Korchev Y, Krishnakumar S, Volynski K, et al. Kv1.1 channelopathy abolishes presynaptic spike width modulation by subthreshold somatic depolarization. Proc Natl Acad Sci U S A. 2017;114:2395-2400 pubmed publisher
Begum R, Bakiri Y, Volynski K, Kullmann D. Action potential broadening in a presynaptic channelopathy. Nat Commun. 2016;7:12102 pubmed publisher
Fellerhoff Losch B, Korol S, Ganor Y, Gu S, Cooper I, Eilam R, et al. Normal human CD4(+) helper T cells express Kv1.1 voltage-gated K(+) channels, and selective Kv1.1 block in T cells induces by itself robust TNFÎ± production and secretion and activation of the NFÎºB non-canonical pathway. J Neural Transm (Vienna). 2016;123:137-57 pubmed publisher
Murray J, Qian Y, Liu B, Elliott R, Aral J, Park C, et al. Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015;58:6784-802 pubmed publisher
Smith K, Browne L, Selwood D, McAlpine D, Jagger D. Phosphoinositide Modulation of Heteromeric Kv1 Channels Adjusts Output of Spiral Ganglion Neurons from Hearing Mice. J Neurosci. 2015;35:11221-32 pubmed publisher
Glasscock E, Voigt N, McCauley M, Sun Q, Li N, Chiang D, et al. Expression and function of Kv1.1 potassium channels in human atria from patients with atrial fibrillation. Basic Res Cardiol. 2015;110:505 pubmed publisher
Aiba I, Noebels J. Spreading depolarization in the brainstem mediates sudden cardiorespiratory arrest in mouse SUDEP models. Sci Transl Med. 2015;7:282ra46 pubmed publisher
Lee K, Royston S, Vest M, Ley D, Lee S, Bolton E, et al. N-methyl-D-aspartate receptors mediate activity-dependent down-regulation of potassium channel genes during the expression of homeostatic intrinsic plasticity. Mol Brain. 2015;8:4 pubmed publisher
Hoppa M, Gouzer G, Armbruster M, Ryan T. Control and plasticity of the presynaptic action potential waveform at small CNS nerve terminals. Neuron. 2014;84:778-89 pubmed publisher
Tabarean I. Electrical remodeling of preoptic GABAergic neurons involves the Kv1.5 subunit. PLoS ONE. 2014;9:e96643 pubmed publisher
Wang T, Lee M, Choi E, Pardo Villamizar C, Lee S, Yang I, et al. Granzyme B-induced neurotoxicity is mediated via activation of PAR-1 receptor and Kv1.3 channel. PLoS ONE. 2012;7:e43950 pubmed publisher
Li K, Lu Y, Xu Z, Zhang J, Zhu J, Zhang J, et al. Neuregulin 1 regulates excitability of fast-spiking neurons through Kv1.1 and acts in epilepsy. Nat Neurosci. 2011;15:267-73 pubmed publisher
Baker M, Chen Y, Shah S, Okuse K. In vitro and intrathecal siRNA mediated K(V)1.1 knock-down in primary sensory neurons. Mol Cell Neurosci. 2011;48:258-65 pubmed publisher
Martel P, Leo D, Fulton S, Bérard M, Trudeau L. Role of Kv1 potassium channels in regulating dopamine release and presynaptic D2 receptor function. PLoS ONE. 2011;6:e20402 pubmed publisher
Fulton S, Thibault D, Mendez J, Lahaie N, Tirotta E, Borrelli E, et al. Contribution of Kv1.2 voltage-gated potassium channel to D2 autoreceptor regulation of axonal dopamine overflow. J Biol Chem. 2011;286:9360-72 pubmed publisher
Madrid R, De La Pena E, Donovan Rodriguez T, Belmonte C, Viana F. Variable threshold of trigeminal cold-thermosensitive neurons is determined by a balance between TRPM8 and Kv1 potassium channels. J Neurosci. 2009;29:3120-31 pubmed publisher
Yang Q, Chen S, Li D, Pan H. Kv1.1/1.2 channels are downstream effectors of nitric oxide on synaptic GABA release to preautonomic neurons in the paraventricular nucleus. Neuroscience. 2007;149:315-27 pubmed
Guan D, Lee J, Tkatch T, Surmeier D, Armstrong W, Foehring R. Expression and biophysical properties of Kv1 channels in supragranular neocortical pyramidal neurones. J Physiol. 2006;571:371-89 pubmed
Speake T, Kibble J, Brown P. Kv1.1 and Kv1.3 channels contribute to the delayed-rectifying K+ conductance in rat choroid plexus epithelial cells. Am J Physiol Cell Physiol. 2004;286:C611-20 pubmed
Liu Q, Fleischmann B, Hondowicz B, Maier C, Turka L, Yui K, et al. Modulation of Kv channel expression and function by TCR and costimulatory signals during peripheral CD4(+) lymphocyte differentiation. J Exp Med. 2002;196:897-909 pubmed

image

image 1 :

Alomone Labs Dendrotoxin-K inhibits KV1.1 channel currents heterologously expressed inXenopusoocytes. - A. Time course at plateau ofDendrotoxin-K(#D-400) action on KV1.1 currents. Current amplitude at plateau was plotted as a function of time. Membrane potential was held at -80 mV and oocytes were stimulated by a 100 ms voltage ramp to -10 mV. 1 nM Dendrotoxin-K (applied for 2 min green) were perfused during the period marked by the bar (as indicated) and showed 70-80% inhibition of control current. B. Superimposed traces of channel current in the absence (black) and presence (green) of 1 nM Dendrotoxin-K (taken from experiment in A).

image 2 :

GST fusion protein with the sequence SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC corresponding to residues 1097-1196 of mouse KCNMA1variant 2 (AccessionQ08460-2). Intracellular C-terminus.

product information

cat :

D-400

SKU :

D-400_10 mcg

Product Name :

Dendrotoxin-K

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P00981

Accession Number :

https://www.uniprot.org/uniprotkb/P00981/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Dendroaspis polylepis polylepis (Black mamba snake).

Source :

Natural protein

Gene ID :

KCNA1

Product Page - Scientific background :

Dendrotoxin-K is isolated from Dendroaspis p.polylepis snake venom by modification of the procedure of Schweitz1 and purified to homogeneity. It blocks mainly KV1.1 (EC50=0.6 nM2) and Kv1.1-containing heterooligomer.

Supplier :

Alomone Labs

Target :

KV1.1, Kv1.1-containing heterooligomer.

Long Description :

A Potent Blocker of KV1.1 and KV1.2 Channels

Short Description :

A Potent Blocker of KV1.1 and KV1.2 Channels

MW :

6560 Da

Synonyms :

Venom basic protease inhibitor K, DTX-K

Modifications :

Disulfide bonds between: Cys5-Cys55, Cys14-Cys38, and Cys30-Cys51

Molecular formula :

C294H456N84O75S6

Effective Concentration :

100 nM

Activity :

Dendrotoxin-K is a highly selective and potent blocker of voltage-gated K+ channels KV1.1 and Kv1.1-containing heterooligomer.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥99% (HPLC)

CAS No :

119128-61-9

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

AAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCG
GNANRFKTIEECRRTCVG-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

Cited Application :

Electrophysiology

more info or order :

Alomone Labs product webpage