Dendrotoxin-I | Alomone Labs D-390 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Dendrotoxin-I

catalog :

D-390

more info or order :

Alomone Labs product webpage

citations: 9

Reference
Zurita H, Feyen P, Apicella A. Layer 5 Callosal Parvalbumin-Expressing Neurons: A Distinct Functional Group of GABAergic Neurons. Front Cell Neurosci. 2018;12:53 pubmed publisher
Sforna L, D Adamo M, Servettini I, Guglielmi L, Pessia M, Franciolini F, et al. Expression and function of a CP339,818-sensitive Kâº current in a subpopulation of putative nociceptive neurons from adult mouse trigeminal ganglia. J Neurophysiol. 2015;113:2653-65 pubmed publisher
Hardman R, Forsythe I. Ether-à-go-go-related gene K+ channels contribute to threshold excitability of mouse auditory brainstem neurons. J Physiol. 2009;587:2487-97 pubmed publisher
Johnston J, Griffin S, Baker C, Skrzypiec A, Chernova T, Forsythe I. Initial segment Kv2.2 channels mediate a slow delayed rectifier and maintain high frequency action potential firing in medial nucleus of the trapezoid body neurons. J Physiol. 2008;586:3493-509 pubmed publisher
Johnston J, Griffin S, Baker C, Forsythe I. Kv4 (A-type) potassium currents in the mouse medial nucleus of the trapezoid body. Eur J Neurosci. 2008;27:1391-9 pubmed publisher
Eftekharpour E, Karimi Abdolrezaee S, Sinha K, Velumian A, Kwiecien J, Fehlings M. Structural and functional alterations of spinal cord axons in adult Long Evans Shaker (LES) dysmyelinated rats. Exp Neurol. 2005;193:334-49 pubmed
Liu Q, Fleischmann B, Hondowicz B, Maier C, Turka L, Yui K, et al. Modulation of Kv channel expression and function by TCR and costimulatory signals during peripheral CD4(+) lymphocyte differentiation. J Exp Med. 2002;196:897-909 pubmed
Favre I, Moczydlowski E. Simultaneous binding of basic peptides at intracellular sites on a large conductance Ca2+-activated K+ channel. Equilibrium and kinetic basis of negatively coupled ligand interactions. J Gen Physiol. 1999;113:295-320 pubmed
Petersson J, Zygmunt P, Högestätt E. Characterization of the potassium channels involved in EDHF-mediated relaxation in cerebral arteries. Br J Pharmacol. 1997;120:1344-50 pubmed

image

image 1 :

Alomone Labs Dendrotoxin-I inhibits KV1.1 and KV1.2 channel currents heterologously expressed inXenopusoocytes. - KV1.1 (left in 2 mM K+) and KV1.2 (right in 5 mM K+) channel currents elicited by 200 ms depolarization from holding potential of -100 mV to +20 mV before and during application of 100 nMDendrotoxin-I(#D-390). 92% (n = 4) of the KV1.1 and 84% (n = 4) of the KV1.2 channels currents were inhibited by 100 nM Dendrotoxin-I respectively.

image 2 :

Alomone Labs Cl-HIBO activates GluA1 receptors expressed inXenopusoocytes. - Time course of current reversibly activated by 1 M 10 M and 100 MCl-HIBO(#C-355) as indicated while membrane potential was held at -60 mV.

product information

cat :

D-390

SKU :

D-390_0.1 mg

Product Name :

Dendrotoxin-I

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P00979

Accession Number :

https://www.uniprot.org/uniprotkb/P00979/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Dendroaspis polylepis polylepis (Black mamba snake).

Source :

Natural protein

Gene ID :

KCNA1 ,KCNA2 ,KCNA6

Product Page - Scientific background :

Dendrotoxin-I is isolated from Dendroaspis p.polylepis snake venom by modification of the procedure of Schweitz1 and purified to homogeneity.Dendrotoxin-I blocks KV1.2 and KV1.1 channels (IC50=0.13 and 3.1 nM in oocytes respectively, with higher values for mammalian cells)3 as well as heteromultimeric channels containing these, with other KV1 isoforms2 (for review see 3).

Supplier :

Alomone Labs

Target :

KV1.1, KV1.2 K+ channels

Long Description :

A Potent Blocker of KV1.1 and KV1.2 Channels

Short Description :

A Potent Blocker of KV1.1 and KV1.2 Channels

MW :

7149 Da

Synonyms :

Venom basic protease inhibitor 1, Dendrotoxin-1, DTX-I, DTX-1

Modifications :

Disulfide bonds between: Cys7-Cys57, Cys16-Cys40, and Cys32-Cys53

Molecular formula :

C312H491N99O83S6

Effective Concentration :

10 - 100 nM

Activity :

Dendrotoxin-I is a highly selective blocker of voltage-gated K+ channels (KV1.1 and KV1.2), as well as heteromultimeric channels containing these, with other KV1 isoforms1. The inhibition effect is higher in Xenopus oocytes compared to mammalian cells2.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

107950-33-4

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSG
CGGNSNRFKTIEECRRTCIRK-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage