product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Dendrotoxin-I
catalog :
D-390
more info or order :
citations: 9
Reference
Zurita H, Feyen P, Apicella A. Layer 5 Callosal Parvalbumin-Expressing Neurons: A Distinct Functional Group of GABAergic Neurons. Front Cell Neurosci. 2018;12:53 pubmed publisher
Sforna L, D Adamo M, Servettini I, Guglielmi L, Pessia M, Franciolini F, et al. Expression and function of a CP339,818-sensitive K⁺ current in a subpopulation of putative nociceptive neurons from adult mouse trigeminal ganglia. J Neurophysiol. 2015;113:2653-65 pubmed publisher
Hardman R, Forsythe I. Ether-à-go-go-related gene K+ channels contribute to threshold excitability of mouse auditory brainstem neurons. J Physiol. 2009;587:2487-97 pubmed publisher
Johnston J, Griffin S, Baker C, Skrzypiec A, Chernova T, Forsythe I. Initial segment Kv2.2 channels mediate a slow delayed rectifier and maintain high frequency action potential firing in medial nucleus of the trapezoid body neurons. J Physiol. 2008;586:3493-509 pubmed publisher
Johnston J, Griffin S, Baker C, Forsythe I. Kv4 (A-type) potassium currents in the mouse medial nucleus of the trapezoid body. Eur J Neurosci. 2008;27:1391-9 pubmed publisher
Eftekharpour E, Karimi Abdolrezaee S, Sinha K, Velumian A, Kwiecien J, Fehlings M. Structural and functional alterations of spinal cord axons in adult Long Evans Shaker (LES) dysmyelinated rats. Exp Neurol. 2005;193:334-49 pubmed
Liu Q, Fleischmann B, Hondowicz B, Maier C, Turka L, Yui K, et al. Modulation of Kv channel expression and function by TCR and costimulatory signals during peripheral CD4(+) lymphocyte differentiation. J Exp Med. 2002;196:897-909 pubmed
Favre I, Moczydlowski E. Simultaneous binding of basic peptides at intracellular sites on a large conductance Ca2+-activated K+ channel. Equilibrium and kinetic basis of negatively coupled ligand interactions. J Gen Physiol. 1999;113:295-320 pubmed
Petersson J, Zygmunt P, Högestätt E. Characterization of the potassium channels involved in EDHF-mediated relaxation in cerebral arteries. Br J Pharmacol. 1997;120:1344-50 pubmed
image
image 1 :
Alomone Labs D-390 image 1
Alomone Labs Dendrotoxin-I inhibits KV1.1 and KV1.2 channel currents heterologously expressed inXenopusoocytes. - KV1.1 (left in 2 mM K+) and KV1.2 (right in 5 mM K+) channel currents elicited by 200 ms depolarization from holding potential of -100 mV to +20 mV before and during application of 100 nMDendrotoxin-I(#D-390). 92% (n = 4) of the KV1.1 and 84% (n = 4) of the KV1.2 channels currents were inhibited by 100 nM Dendrotoxin-I respectively.
image 2 :
Alomone Labs D-390 image 2
Alomone Labs Cl-HIBO activates GluA1 receptors expressed inXenopusoocytes. - Time course of current reversibly activated by 1 M 10 M and 100 MCl-HIBO(#C-355) as indicated while membrane potential was held at -60 mV.
product information
cat :
D-390
SKU :
D-390_0.1 mg
Product Name :
Dendrotoxin-I
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P00979
Accession Number :
https://www.uniprot.org/uniprotkb/P00979/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis polylepis polylepis (Black mamba snake).
Source :
Natural protein
Gene ID :
KCNA1 ,KCNA2 ,KCNA6
Product Page - Scientific background :
Dendrotoxin-I is isolated from Dendroaspis p.polylepis snake venom by modification of the procedure of Schweitz1 and purified to homogeneity.Dendrotoxin-I blocks KV1.2 and KV1.1 channels (IC50=0.13 and 3.1 nM in oocytes respectively, with higher values for mammalian cells)3 as well as heteromultimeric channels containing these, with other KV1 isoforms2 (for review see 3).
Supplier :
Alomone Labs
Target :
KV1.1, KV1.2 K+ channels
Long Description :
A Potent Blocker of KV1.1 and KV1.2 Channels
Short Description :
A Potent Blocker of KV1.1 and KV1.2 Channels
MW :
7149 Da
Synonyms :
Venom basic protease inhibitor 1, Dendrotoxin-1, DTX-I, DTX-1
Modifications :
Disulfide bonds between: Cys7-Cys57, Cys16-Cys40, and Cys32-Cys53
Molecular formula :
C312H491N99O83S6
Effective Concentration :
10 - 100 nM
Activity :
Dendrotoxin-I is a highly selective blocker of voltage-gated K+ channels (KV1.1 and KV1.2), as well as heteromultimeric channels containing these, with other KV1 isoforms1. The inhibition effect is higher in Xenopus oocytes compared to mammalian cells2.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
107950-33-4
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSG
CGGNSNRFKTIEECRRTCIRK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel