product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
δ-Dendrotoxin
catalog :
D-380
more info or order :
citations: 4
| Reference |
|---|
Guan D, Lee J, Tkatch T, Surmeier D, Armstrong W, Foehring R. Expression and biophysical properties of Kv1 channels in supragranular neocortical pyramidal neurones. J Physiol. 2006;571:371-89 pubmed
|
Khavandgar S, Walter J, Sageser K, Khodakhah K. Kv1 channels selectively prevent dendritic hyperexcitability in rat Purkinje cells. J Physiol. 2005;569:545-57 pubmed
|
Southan A, Owen D. The contrasting effects of dendrotoxins and other potassium channel blockers in the CA1 and dentate gyrus regions of rat hippocampal slices. Br J Pharmacol. 1997;122:335-43 pubmed
|
Owen D, Hall A, Stephens G, Stow J, Robertson B. The relative potencies of dendrotoxins as blockers of the cloned voltage-gated K+ channel, mKv1.1 (MK-1), when stably expressed in Chinese hamster ovary cells. Br J Pharmacol. 1997;120:1029-34 pubmed
|
image
image 1 :

Alomone Labs ?-Dendrotoxin inhibits KV1.1 and KV1.2 channel currents heterologously expressed inXenopusoocytes. - KV1.1 (left in 2 mM K+) and KV1.2 (right in 5 mM K+) channel currents elicited by 200 ms depolarization from a holding potential of -100 mV to +20 mV before and during application of 100 nM?-Dendrotoxin(#D-380). 92% (n = 4) of the KV1.1 and 20% (n = 4) of the KV1.2 channels were inhibited by ?-Dendrotoxin respectively.
product information
cat :
D-380
SKU :
D-380_0.5 mg
Product Name :
δ-Dendrotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P00982
Accession Number :
https://www.uniprot.org/uniprotkb/P00982/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Dendroaspis angusticeps (Eastern green mamba).
Source :
Natural protein
Gene ID :
KCNA1 ,KCNA6,KCNJ1
Product Page - Scientific background :
δ-Dendrotoxin is isolated from Dendroaspis angusticeps1 snake venom by modification of the procedures of Harvey2 and Benishin1 and purified to homogeneity.δ-Dendrotoxin blocks KV1.1 channels (IC50 = 0.1 nM,3 for review see 4). The toxin was shown to also block KV1.6 (IC50= 23 nM).4 In addition δ-Dendrotoxin blocks ROMK1 inward rectifier K+ channels with Kd of 150 nM3
Supplier :
Alomone Labs
Target :
KV1.1, KV1.6 and Kir1.1 K+ channels
Long Description :
A Potent and Specific Blocker of KV1.1 Channels and a Less Potent Blocker of Kir1.1 (ROMK1) Channels
Short Description :
A Potent and Specific Blocker of KV1.1 Channels and a Less Potent Blocker of Kir1.1 (ROMK1) Channels
MW :
6568 Da
Modifications :
Disulfide bonds between: Cys5-Cys55, Cys14-Cys38 and Cys30-Cys51
Molecular formula :
C296H452N82O76S6
Effective Concentration :
10 - 100 nM
Activity :
δ-Dendrotoxin inhibits 4-AP sensitive, inactivating voltage-gated K+ channels (KV1.1, KV1.2 and KV1.6). In addition δ-Dendrotoxin inhibits ROMK1 channel currents.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
AAKYCKLPVRYGPCKKKIPSFYYKWKAKQCLPFDYSGCG
GNANRFKTIEECRRTCVG-OH
GNANRFKTIEECRRTCVG-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
