δ-Dendrotoxin | Alomone Labs D-380 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

δ-Dendrotoxin

catalog :

D-380

more info or order :

Alomone Labs product webpage

citations: 4

Reference
Guan D, Lee J, Tkatch T, Surmeier D, Armstrong W, Foehring R. Expression and biophysical properties of Kv1 channels in supragranular neocortical pyramidal neurones. J Physiol. 2006;571:371-89 pubmed
Khavandgar S, Walter J, Sageser K, Khodakhah K. Kv1 channels selectively prevent dendritic hyperexcitability in rat Purkinje cells. J Physiol. 2005;569:545-57 pubmed
Southan A, Owen D. The contrasting effects of dendrotoxins and other potassium channel blockers in the CA1 and dentate gyrus regions of rat hippocampal slices. Br J Pharmacol. 1997;122:335-43 pubmed
Owen D, Hall A, Stephens G, Stow J, Robertson B. The relative potencies of dendrotoxins as blockers of the cloned voltage-gated K+ channel, mKv1.1 (MK-1), when stably expressed in Chinese hamster ovary cells. Br J Pharmacol. 1997;120:1029-34 pubmed

image

image 1 :

Alomone Labs ?-Dendrotoxin inhibits KV1.1 and KV1.2 channel currents heterologously expressed inXenopusoocytes. - KV1.1 (left in 2 mM K+) and KV1.2 (right in 5 mM K+) channel currents elicited by 200 ms depolarization from a holding potential of -100 mV to +20 mV before and during application of 100 nM?-Dendrotoxin(#D-380). 92% (n = 4) of the KV1.1 and 20% (n = 4) of the KV1.2 channels were inhibited by ?-Dendrotoxin respectively.

product information

cat :

D-380

SKU :

D-380_0.5 mg

Product Name :

δ-Dendrotoxin

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P00982

Accession Number :

https://www.uniprot.org/uniprotkb/P00982/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Dendroaspis angusticeps (Eastern green mamba).

Source :

Natural protein

Gene ID :

KCNA1 ,KCNA6,KCNJ1

Product Page - Scientific background :

δ-Dendrotoxin is isolated from Dendroaspis angusticeps1 snake venom by modification of the procedures of Harvey2 and Benishin1 and purified to homogeneity.δ-Dendrotoxin blocks KV1.1 channels (IC50 = 0.1 nM,3 for review see 4). The toxin was shown to also block KV1.6 (IC50= 23 nM).4 In addition δ-Dendrotoxin blocks ROMK1 inward rectifier K+ channels with Kd of 150 nM3

Supplier :

Alomone Labs

Target :

KV1.1, KV1.6 and Kir1.1 K+ channels

Long Description :

A Potent and Specific Blocker of KV1.1 Channels and a Less Potent Blocker of Kir1.1 (ROMK1) Channels

Short Description :

A Potent and Specific Blocker of KV1.1 Channels and a Less Potent Blocker of Kir1.1 (ROMK1) Channels

MW :

6568 Da

Modifications :

Disulfide bonds between: Cys5-Cys55, Cys14-Cys38 and Cys30-Cys51

Molecular formula :

C296H452N82O76S6

Effective Concentration :

10 - 100 nM

Activity :

δ-Dendrotoxin inhibits 4-AP sensitive, inactivating voltage-gated K+ channels (KV1.1, KV1.2 and KV1.6). In addition δ-Dendrotoxin inhibits ROMK1 channel currents.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

AAKYCKLPVRYGPCKKKIPSFYYKWKAKQCLPFDYSGCG
GNANRFKTIEECRRTCVG-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage