product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant rat CNTF protein
catalog :
C-245
more info or order :
citations: 5
| Reference |
|---|
image
image 1 :

image 2 :

Alomone Labs Recombinant rat CNTF protein differentially promotes the activation of STAT3 and ERK in adipocyte and preadipocyte 3T3 L1 cells. - Cells were stimulated with increasing concentrations of Recombinantrat CNTF protein(#C-245) for 10 min. The cells were subjected to western blot analysis and the activation of ERK and Stat3 were determinedusing anti-phospho-ERK and anti-phospho-Stat3.
product information
cat :
C-245
SKU :
C-245_0.1 mg
Product Name :
Recombinant rat CNTF protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P20294
Accession Number :
https://www.uniprot.org/uniprotkb/P20294/entry#function
Applications :
Western blot
Formulation :
Lyophilized from double distilled water (ddH2O).
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
IL6ST, CNTFR, LIFR
Product Page - Scientific background :
CNTF is a polypeptide trophic factor, a member of the alpha-helical cytokine superfamily1. It was initially purified from the chick eye on the basis of its ability to promote survival of E8 chick ciliary ganglion neurons in culture2. CNTF is synthesized by glia both in the CNS and PNS3 and it has been shown to be ubiquitously distributed in neurons and glia throughout the rodent brain4. CNTF effects are mediated by a tripartite receptor complex consisting of two signal-transducing subunits (leukemia inhibitory factor receptor, gp130) and a CNTF-specific ligand-binding-subunit (CNTFR)5.CNTF can support the survival of many different cell populations within the PNS and CNS6. In vitro, CNTF promotes proliferation and neuronal specifications in hippocampal neurons. In vivo, it supports the viability of non-primate motor neurons7, induces sprouting of cholinergic motor neurons8 and delays neural degeneration in genetic models of motor neuron disease9. In addition, it is involved in the development stage of astrocytes and oligodendocytes10.
Supplier :
Alomone Labs
Target :
leukemia inhibitory factor receptor, gp130, CNTFR
Long Description :
Rat Ciliary Neurotrophic Factor, Recombinant, E. coli
Short Description :
Rat Ciliary Neurotrophic Factor, Recombinant, E. coli
MW :
22.7 kDa
Synonyms :
Ciliary Neurotrophic Factor
Effective Concentration :
EC50 = ~2.2 pM
Activity :
CNTF is a potent neurotrophic factor that was originally characterized as a survival factor for chick ciliary neurons. CNTF supports growth and survival of DRG, motor and sympathetic neurons1-4.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVK
HQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQA
YRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSA
FAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLW
GLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAK
DKQM
HQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQA
YRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSA
FAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLW
GLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAK
DKQM
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
