chemical

Recombinant human CNTF protein

C-240

C-240_0.1 mg

Recombinant human CNTF protein

Non Antibodies

Proteins

P26441

https://www.uniprot.org/uniprotkb/P26441/entry

Western blot

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

IL6ST, CNTFR, LIFR

CNTF is a polypeptide trophic factor, a member of the alpha-helical cytokine superfamily1. It was initially purified from the chick eye on the basis of its ability to promote survival of E8 chick ciliary ganglion neurons in culture2. CNTF is synthesized by glia both in the CNS and PNS3 and it has been shown to be ubiquitously distributed in neurons and glia throughout the rodent brain4. CNTF effects are mediated by a tripartite receptor complex consisting of two signal-transducing subunits (leukemia inhibitory factor receptor, gp130) and a CNTF-specific ligand-binding-subunit (CNTFR)5.CNTF can support the survival of many different cell populations within the PNS and CNS6. In vitro, CNTF promotes proliferation and neuronal specifications in hippocampal neurons. In vivo, it supports the viability of non-primate motor neurons7, induces sprouting of cholinergic motor neurons8 and delays neural degeneration in genetic models of motor neuron disease9. In addition, it is involved in the development stage of astrocytes and oligodendocytes10.

Alomone Labs

leukemia inhibitory factor receptor, gp130, CNTFR

Human Ciliary Neurotrophic Factor, Recombinant, E. coli

Human Ciliary Neurotrophic Factor, Recombinant, E. coli

22.9 kDa

Ciliary Neurotrophic Factor

EC50 = 1 nM

CNTF is a potent neurotrophic factor that was originally characterized as a survival factor for chick ciliary neurons. CNTF supports growth and survival of DRG, motor and sympathetic neurons1-4.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYV
KHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQ
AYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVA
AFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKL
WGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIA
NNKKM

No

12352202

yes

yes