chemical

Recombinant human Cardiotrophin-1 protein

C-200

C-200_10 mcg

Recombinant human Cardiotrophin-1 protein

Non Antibodies

Proteins

Q16619

https://www.uniprot.org/uniprotkb/Q16619/entry

Western blot

Lyophilized from double distilled water (ddH2O).

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Recombinant, E. coli

IL6ST

Cardiotrophin-1 is a member of the neuropoietic cytokine family (LIF, CNTF, OSM IL-11, IL-6). Cardiotrophin-1 is a strong inducer of cardiac hypertrophy, exerts cardio-protective effects and plays a role in neuronal growth and differentiation.1,2In neonatal rat, Cardiotrophin-1 has been shown to promote cardiac myocyte survival and to enhance embryonic myocyte proliferation during cardiac chamber development.3 Cardiotrophin-1 increases angiotensinogen gene transcription and induces VEGF expression in cardiac myocytes.4,5 It also induces vessel growth during cardiac remodelling, an effect that may contribute to its cardio-protective properties.In humans, a recent report showed an increase in circulating Cardiotrophin-1 in heart failure.6 A strong correlation between the increased Cardiotrophin-1 and the severity of left ventricular systolic dysfunction was found.7Cardiotrophin-1 is a very potent neurotrophic factor for motoneurons in long-term culture and protects neonatal rat motoneurons from axotomy-induced cell death.2,8 It was able to modulate the synthesis of specific neurotransmitters by cultured neuronal cells,9 and to promote the survival of rat dopaminergic and chick ciliary neurons.10 Recently, the potential for neuroprotection by Cardiotrophin-1 was investigated in animal models characterized by a prominent axonal degeneration.11-13

Alomone Labs

ILST/gp130 receptors

human Cardiotrophin-1, Recombinant, E. coli

human Cardiotrophin-1, Recombinant, E. coli

21.1 kDa

CT-1

10 - 100 nM

Cardiotrophin-1 is a member of the neuropoietic cytokine family which enhances the survival of ciliary and dopaminergic neurons through the interaction with the gp130 receptor. Cardiotrophin-1 induces cardiac myocyte hypertrophy and has been shown to promote the survival of both embryonic and neonatal rat ventricular muscle cells1-3.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKY
AEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHA
GLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRL
LRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAA
TASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLL
PGGSA

No

12352202

yes

yes