product summary
Loading...
company name :
Alomone Labs
product type :
protein
product name :
SNAP-25 Blocking Peptide
catalog :
BLP-NR001
more info or order :
image
image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-SNAP-25 Antibody (#ANR-001), (1:1000).2. Anti-SNAP-25 Antibody, preincubated with the control fusion protein antigen.
product information
CAT :
BLP-NR001
SKU :
BLP-NR001
Product Name :
SNAP-25 Blocking Peptide
Group Type :
Blocking Peptide
Type :
GST fusion protein
Product Type :
BLP
Accession :
P60881
Applications :
WB IHC
Formulation :
Lyophilized Powder.
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Storage After Reconstitution :
-20°C.
Storage Before Reconstitution :
Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
Sequence :
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG, corresponding to the full-length of rat SNAP-25
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEES
KDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNL
TDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQP
ARV
GST fusion protein with the sequence
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEES
KDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNL
TDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQP
ARV
GST fusion protein with the sequence
Applications may also work in :
WB IHC
Supplier :
Alomone Labs
Target :
SNAP25
Long Description :
SNAP-25 Blocking Peptide (#BLP-NR001) is the original antigen used for immunization during Anti-SNAP-25 Antibody (#ANR-001) generation. The blocking peptide binds and 'blocks' Anti-SNAP-25 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Short Description :
A Blocking Peptide for Anti-SNAP-25 Antibody
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Form :
Lyophilized powder
Comment :
Contact Alomone Labs for technical support and product customization
Is Toxin :
No
UNSPSC :
41105329
Standard quality control of each lot :
Western blot analysis.
Reconstitution :
100 μl PBS
Purity :
>95% (SDS-PAGE)
Concentration after reconstitution :
0.5 mg/ml.
Product page antibodies part of immunoge ... :
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG, corresponding to the full-length of rat SNAP-25
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEES
KDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNL
TDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQP
ARV
GST fusion protein with the sequence
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEES
KDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNL
TDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQP
ARV
GST fusion protein with the sequence
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments
