BDS-II | Alomone Labs B-450 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

BDS-II

catalog :

B-450

more info or order :

Alomone Labs product webpage

citations: 2

Reference
Kanyshkova T, Broicher T, Meuth S, Pape H, Budde T. A-type K+ currents in intralaminar thalamocortical relay neurons. Pflugers Arch. 2011;461:545-56 pubmed publisher
Dallas M, Morris N, Lewis D, Deuchars S, Deuchars J. Voltage-gated potassium currents within the dorsal vagal nucleus: inhibition by BDS toxin. Brain Res. 2008;1189:51-7 pubmed

image

image 1 :

BDS-II inhibits KV3.4 channels heterologously expressed inXenopusoocytes. - Left: Example traces before (red) and during (black) bath perfusion of 1 MBDS-II(#B-450). Holding potential was -100 mV test potential to 0 mV (100 ms) was delivered every 10 seconds. Recordings were made while perfusing ND 96 Buffer. Right: Time course for the experiment shown on the left. The vertical bar indicates the period of BDS-II perfusion.

image 2 :

Peptide CSSHFPYSQYQFWKN corresponding to amino acid residues 178-192 of human CCR5 (Accession P51681). 2nd extracellular loop.

product information

cat :

B-450

SKU :

B-450_0.1 mg

Product Name :

BDS-II

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P59084

Accession Number :

https://www.uniprot.org/uniprotkb/P59084/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O).

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Anemonia sulcata (Mediterranean snakelocks sea anemone).

Source :

Natural peptide

Gene ID :

KCNC1,KCNC2,KCNC4,SCN9A

Product Page - Scientific background :

BDS-II is a 43 amino acid peptidyl toxin isolated from the sea anemone Anemonia sulcata venom. BDS-II was shown to be a specific KV3.4 blocker. BDS-II blocked 70% of the KV3.4 current in COS-transfected cells at a concentration of 2.8 µM The blocking effect was rapid, direct and reversible1. Recently it was shown that BDS-II blocks other KV3 channels with similar potencies.2The closely related BDS-I was shown to modulate voltage-gated Na+ channels. It enhanced TTX-sensitive Na+ channels (highly effective on NaV1.7 channels), and weakly inhibited TTX-resistant NaV channels3. As such, we showed that BDS-II also potently inhibits NaV1.7 channels (see Our Bioassay).

Supplier :

Alomone Labs

Target :

KV3 K+ channels, NaV Na+ channels

Long Description :

A Blocker of KV3 Channels and a Modulator of NaV Channels

Short Description :

A Blocker of KV3 Channels and a Modulator of NaV Channels

MW :

4776.4 Da

Synonyms :

DeltaKappa-actitoxin-Avd4b, Blood depressing substance II, Blood depressing substance 2

Modifications :

Disulfide bonds between: Cys4-Cys39, Cys6-Cys32, and Cys22-Cys40

Molecular formula :

C214H301N57O57S6

Effective Concentration :

100 nM - 5 µM

Activity :

BDS-II blocks the KV3.4 current. The blocking effect is rapid, direct and reversible1. BDS-II also modulates voltage-gated Na+ channels (in-house data).

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

>95% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

AAPCFCPGKPDRGDLWILRGTCPGGYGYTSNCYKWPNIC
CYPH-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage