product summary
Loading...
company name :
Alomone Labs
product type :
protein
product name :
κ-Bungarotoxin
catalog :
B-300
more info or order :
product information
cat :
B-300
SKU :
B-300_0.1 mg
Product Name :
κ-Bungarotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P01398
Accession Number :
https://www.uniprot.org/uniprotkb/P01398/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Bungarus multicinctus (Many-banded krait)
Source :
Natural protein
Gene ID :
CHRNA3, CHRNA7, CHRNA4, CHRNB2
Product Page - Scientific background :
Kappa-bungarotoxin (κ-Bungarotoxin, κ-Bgt) is a 66 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1,2. κ-Bgt is a postsynaptic neurotoxin that potently binds and inhibits the neuronal types of nicotinic acetylcholine receptors (nAChR). It is a selective antagonist of α3-containing and some α4-containing nAChRs subunits3.Under physiological solvent conditions, κ-Bungarotoxin exists as a non-covalent homodimer4. The dimeric nature of the toxin may play a crucial role in the binding properties of κ-Bgt to neuronal types of AChRs while losing its potency on muscle receptors4-6.Neuronal nicotinic acetylcholine receptors (nAChRs) are prototypical cation-selective, ligand-gated ion channels that mediate fast neurotransmission in the central and peripheral nervous systems. nAChRs are involved in a range of physiological and pathological functions and hence are important therapeutic targets7. The κ-neurotoxins have been valuable pharmacological tools in the study of neuronal AChRs3.
Supplier :
Alomone Labs
Target :
α3/β2 Neuronal nAChR
Long Description :
A Potent Antagonist of α3/β2 Neuronal nAChR
Short Description :
A Potent Antagonist of α3/β2 Neuronal nAChR
MW :
7265 Da
Synonyms :
kappa-Bungarotoxin, Kappa-bgt, Kappa-1-bungarotoxin, Long neurotoxin 2,Neuronal bungarotoxin, nBgt, Toxin F
Modifications :
Disulfide bonds between: Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64
Molecular formula :
C303H475N91O97S10
Effective Concentration :
5 - 25 nM
Activity :
Kappa-bungarotoxin is a postsynaptic neurotoxin that potently binds and inhibits the neuronal types of nicotinic acetylcholine receptors (nAChR). It is a selective antagonist of most α3-containing and some α4-containing nAChRs subunits1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
TDNCNH-OH
RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIE
QGCVATCPQFRSNYRSLLCCT
RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIE
QGCVATCPQFRSNYRSLLCCT
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
