product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human proBDNF (cleavage resistant) protein
catalog :
B-256
more info or order :
citations: 2
Reference
Fleitas C, Piñol Ripoll G, Marfull P, Rocandio D, Ferrer I, Rampon C, et al. proBDNF is modified by advanced glycation end products in Alzheimer's disease and causes neuronal apoptosis by inducing p75 neurotrophin receptor processing. Mol Brain. 2018;11:68 pubmed publisher
Luo C, Zhong X, Zhou F, Li J, Zhou P, Xu J, et al. Peripheral Brain Derived Neurotrophic Factor Precursor Regulates Pain as an Inflammatory Mediator. Sci Rep. 2016;6:27171 pubmed publisher
image
image 1 :
Alomone Labs B-256 image 1
Alomone Labs Recombinant human proBDNF (cleavage resistant) protein mediatesneurites outgrowth in TrkB transfected PC12 cells. - Cells were transiently transfected with TrkB/pcDNA3 containing the green fluorescence protein (GFP) as a reporter. One day post transfection the cells were stimulated with 20 ng/ml Recombinanthuman proBDNF (cleavage resistant) protein(#B-256) or 10ng/mlRecombinant human BDNF protein(#B-250). Development of neurites was visualized after 6 days using bright light microscopy.
image 2 :
Alomone Labs B-256 image 2
Alomone Labs Recombinanthuman proBDNF (cleavage resistant)protein activates ERK1/2 MAPKin TrkB transfected HEK 293 cells. - HEK 293 cells stably expressing TrkB receptor were serum-starved for 2h and then challenged for 10 min in the presence or absence of Recombinanthuman proBDNF (cleavage resistant) protein(#B-256)Recombinant humanproBDNF protein(#B-257)Recombinant mouseproBDNF (cleavage resistant) protein(#B-243) orRecombinant human BDNF protein(#B-250). Cell proteins were resolved by SDS PAGE and the level of ERK1/2 phosphorylation determined using anti-phosphoERK.
product information
cat :
B-256
SKU :
B-256_0.1 mg
Product Name :
Recombinant human proBDNF (cleavage resistant) protein
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Western blot, Neurite outgrowth assay
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
NGFR,NTRK2,SORT1,SORCS2
Product Page - Scientific background :
BDNF is a neurotrophic factor produced by proteolytic cleavage of its precursor, proBDNF.1 The actions of BDNF are mediated via the binding to TrkB or p75.2,3The precursor form was thought to be important for the correct folding, secretion and trafficking of the mature protein. A single-nucleotide polymorphism (Val66 to Met) in the pro-domain of the human BDNF gene impairs intracellular trafficking and regulated secretion of BDNF in primary cortical neurons and neurosecretory cells but not in endothelial and vascular cells.4 This has been shown to affect memory and lead to abnormal hippocampal function in humans.5The finding that proBDNF and not mature BDNF is the preferred ligand for p75, has ushered in a new era which reexamines the biological roles of the two forms.6 Some biological roles for proBDNF have been proposed: It has been shown to be a pro-apoptotic ligand for sympathetic neurons7 expressing both p75 and sortlin, and to be involved in LTD8. On the other hand, it has also been shown to elicit prototypical TrkB responses in biological assays, such as TrkB tyrosine phosphorylation, and activation of ERK1/2.9In brain homogenates a mixture of both, proBDNF and mature BDNF has been found10,11 and in cortical neurons secretion of proBDNF has been shown.7 Binding of both proBDNF and mature BDNF to TrkB has been proposed to be via the R103 residue in the mature portion.9
Supplier :
Alomone Labs
Target :
p75NTR, Sortilin receptors
Long Description :
Human proBrain-Derived Neurotrophic Factor (cleavage resistant), Recombinant, E. coli
Short Description :
Human proBrain-Derived Neurotrophic Factor (cleavage resistant), Recombinant, E. coli
MW :
51.41 kDa (dimer)
Synonyms :
proBrain-Derived Neurotrophic Factor
Effective Concentration :
0.1 - 10 nM
Activity :
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
(the prodomain is shown in bold, underlined are the double point mutations preventing cleavage)
MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGL
TSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAGHSDPAR
RGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVS
KGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQ
SYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel