product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
human proBDNF-Biotin
catalog :
B-256-B
more info or order :
image
image 1 :

Alomone Labs NPS 2390 inhibits mGluR1-mediated Ca2+mobilization in U2OS cells. - Dose response of normalized inhibition of human mGluR1 mediated L-Glutamate evoked Ca2+mobilization byNPS 2390(#N-340). IC50was determined at 56.7 nM. hmGluR1-expressing cells were loaded with calcium-sensitive dye incubated with a range of concentrations of NPS 2390 and stimulated by 15 M L-Glutamate (EC80). Changes in intracellular Ca2+following stimulation were detected as changes in maximum relative fluorescence (RLU) using FLIPRTETRA?.
image 2 :

product information
cat :
B-256-B
SKU :
B-256-B_1 mcg
Product Name :
human proBDNF-Biotin
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Western blot, Live imaging
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Modified recombinant protein, E. coli
Gene ID :
NGFR,NTRK2,SORT1,SORCS2
Product Page - Scientific background :
BDNF is a neurotrophic factor produced by proteolytic cleavage of its precursor, proBDNF.1 The actions of BDNF are mediated via the binding to TrkB or p75NTR.2,3The precursor form was thought to be important for the correct folding, secretion and trafficking of the mature protein. A single-nucleotide polymorphism (Val66 to Met) in the pro-domain of the human BDNF gene impairs intracellular trafficking and regulated secretion of BDNF in primary cortical neurons and neurosecretory cells but not in endothelial and vascular cells.4 This has been shown to affect memory and lead to abnormal hippocampal function in humans.5The finding that proBDNF and not mature BDNF is the preferred ligand for p75NTR, has ushered in a new era which reexamines the biological roles of the two forms.6 Some biological roles for proBDNF have been proposed: It has been shown to be a pro-apoptotic ligand for sympathetic neurons7 expressing both p75NTR and sortilin, and to be involved in LTD8. On the other hand, it has also been shown to elicit prototypical TrkB responses in biological assays, such as TrkB tyrosine phosphorylation, and activation of ERK1/2.9In brain homogenates a mixture of both, proBDNF and mature BDNF has been found10,11 and in cortical neurons secretion of proBDNF has been shown.7 Binding of both proBDNF and mature BDNF to TrkB has been proposed to be via the R103 residue in the mature portion.9
Supplier :
Alomone Labs
Target :
p75NTR, Sortilin receptors
Long Description :
Human proBrain-Derived Neurotrophic Factor Conjugated to Biotin
Short Description :
Human proBrain-Derived Neurotrophic Factor Conjugated to Biotin
MW :
~52 kDa (dimer)
Synonyms :
proBrain-Derived Neurotrophic Factor
Modifications :
LC-Biotin
Effective Concentration :
0.1 - 10 nM
Activity :
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
Storage of solutions :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
(the prodomain is shown in bold, underlined are the double point mutations preventing cleavage)
MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGL
TSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAGHSDPAR
RGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVS
KGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQ
SYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGL
TSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAGHSDPAR
RGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVS
KGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQ
SYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
