product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human BDNF protein
catalog :
B-250
more info or order :
citations: 40
| Reference |
|---|
Saba J, López Couselo F, Turati J, Carniglia L, Durand D, De Laurentiis A, et al. Astrocytes from cortex and striatum show differential responses to mitochondrial toxin and BDNF: implications for protection of striatal neurons expressing mutant huntingtin. J Neuroinflammation. 2020;17:290 pubmed publisher
|
Cordón Barris L, Pascual Guiral S, Yang S, Gimenez Llort L, Lope Piedrafita S, Niemeyer C, et al. Mutation of the 3-Phosphoinositide-Dependent Protein Kinase 1 (PDK1) Substrate-Docking Site in the Developing Brain Causes Microcephaly with Abnormal Brain Morphogenesis Independently of Akt, Leading to Impaired Cognition and Disruptive Behaviors. Mol Cell Biol. 2016;36:2967-2982 pubmed publisher
|
Fulgenzi G, Tomassoni Ardori F, Babini L, Becker J, Barrick C, Puverel S, et al. BDNF modulates heart contraction force and long-term homeostasis through truncated TrkB.T1 receptor activation. J Cell Biol. 2015;210:1003-12 pubmed
|
Zeinieh M, Salehi A, Rajkumar V, Barker P. p75NTR-dependent Rac1 activation requires receptor cleavage and activation of an NRAGE and NEDD9 signaling cascade. J Cell Sci. 2015;128:447-59 pubmed
|
image
image 1 :

Alomone Labs BDNF induces ERK1/2 MAPK phosphorylationof theneurotrophin receptor tyrosine kinase B (TrkB) transfected HEK-293 cells. - Transfected cells were serum depleted for 2 h 3 days post-transfection and then challenged with 20 ng/ml Recombinanthuman BDNF protein(#B-250) for 10 min. The cell proteins were resolved by SDS-PAGE and detected with anti-TrkB and anti-phospho-ERK1/2.
product information
cat :
B-250
SKU :
B-250_0.1 mg
Product Name :
Recombinant human BDNF protein
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P23560
Accession Number :
https://www.uniprot.org/uniprotkb/P23560/entry
Applications :
Western blot
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. For long-term storage of diluted solutions, we recommend adding 0.1% BSA. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
NGFR,NTRK2
Product Page - Scientific background :
Brain-derived neurotrophic factor (BDNF) is a member of the NGF family of neurotrophic growth factors, and shares high sequence homology with NGF, NT-3 and NT-4/5.1,2 BDNF is found in neurons of the central nervous systeM It is expressed predominantly in hippocampus, cortex, and amygdaloid complex.3The synthesis of BDNF is subject to regulation by neuronal activity and specific transmitter systems.4BDNF binds to p75NTR, the neurotrophin receptor, and may initiate programmed cell death by acting through this receptor.5 Signal transduction is activated by the dimerization and autophosphorylation of the TrkB receptor.6BDNF supports the survival of primary sensory neurons,7 retinal ganglion cells, basal forebrain cholinergic neurons,8 and mesencephalic dopaminergic neurons in vitro.9 BDNF prevents death of cultured rat spinal motor neurons,10 and rescues substantial numbers of motor neurons after lesioning of the neonatal sciatic or facial nerve.11 Expression is switched on in Schwann cells following peripheral nerve lesion.11 BDNF also inhibits the normal cell death of embryonic chick motor neurons.12BDNF acts in concert with other factors and neurotrophins. The biological activities of BDNF and NT-3 (neurotrophin-3) are additive, and BDNF also interacts with LIF.13The effects of BDNF on motor neurons raise the possibility that it may be useful in treating patients with motor neuropathies and Amyotrophic Lateral Sclerosis (ALS).14
Supplier :
Alomone Labs
Target :
p75NTR, TrkB receptors
Long Description :
Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli
Short Description :
Human Brain-Derived Neurotrophic Factor, Recombinant, E. coli
MW :
27 kDa (dimer)
Synonyms :
Brain-Derived Neurotrophic Factor
Effective Concentration :
ED50 = 220 pM
Activity :
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVL
EKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNS
QCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKR
GR-OH
EKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNS
QCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKR
GR-OH
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments
