product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
human BDNF-Biotin
catalog :
B-250-B
more info or order :
citations: 7
| Reference |
|---|
image
image 1 :

Alomone Labs human BDNF-Biotin induces ERK1/2 MAPK phosphorylation in mouse cortical neurons as BDNF. - Mouse cortical neurons were starved for 4 h and then challenged with 50 ng/mlRecombinant human BDNF protein(#B-250) orhuman BDNF-Biotin(#B-250-B) for 30 min. 20 g of the cell protein lysate were resolved by SDS-PAGE and detected with anti-phospho-ERK1/2 and anti-tubulin (the experiment was performed and the picture was kindly provided by Dr. Eran Perlsson the Dept. of Pharmacology and Physiology Tel-Aviv University).
product information
cat :
B-250-B
SKU :
B-250-B_5 mcg
Product Name :
human BDNF-Biotin
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Western blot, Fluorescence staining, Live cell imaging, Immunofluorescence
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Modified recombinant protein, E. coli
Gene ID :
NGFR,NTRK2
Product Page - Scientific background :
Few examples in the literature emphasize the importance of using BDNF-biotin in living cells experiments. Pardridge, W.M et al. demonstrated that the delivery of BDNF to the brain is non-existent owing to the combined effects of neglible blood brain barrier (BBB) transport and rapid systemic clearance1. The brain delivery of BDNF may be increased by conjugating biotinylated BDNF to BBB drug delivery vectors, such as neutral avidin conjugated to murine monoclonal antibody to the rat transferrin receptor1. Zhang, Y. and Pardridge, W.M further showed that when BDNF is formulated to enable transport across the BBB, the intravenous administration of BDNF results in the reduction in stroke volume and improvement in functional outcome2.Du, J. et al. detected by using BDNF-biotin the ligand-induced TrkB internalization in cultured hippocampal neurons3.Bhattacharyya, A. et al. showed in mature sciatic nerves, that biotinylated BDNF activated Trk receptors function as rapid retrograde signal carriers to execute remote responses to target-derived neurotrophins4.Song, X.Y. et al. proved that exogenous BDNF-biotin is transported by the peripheral nerves following injection into the rat footpad and can be found in the sciatic nerves in fibres and vesicles5. Their data suggest that peripherally applied BDNF may have therapeutic effects on injured spinal cord. Xie, W. et al. followed the trafficking of QD-BDNF (Quantum Dot-BDNF) after its internalization at the axon terminal6. Their result showed that QD-BDNF could be used to track the movement of exogenous BDNF in neurons over long distances and to study the signaling organelles that contain BDNF6.
Supplier :
Alomone Labs
Target :
p75NTR, TrkB receptors
Long Description :
Biotin Labeled human BDNF for Qdot Labeling
Short Description :
Biotin Labeled human BDNF for Qdot Labeling
MW :
~28 kDa (dimer)
Synonyms :
Brain-Derived Neurotrophic Factor
Modifications :
LC-Biotin
Effective Concentration :
ED50 = 220 pM
Activity :
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2.
Storage of solutions :
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVL
EKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNS
QCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKR
GR-OH
EKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNS
QCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKR
GR-OH
Is Toxin :
No
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments
