product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Recombinant human BDNF proDomain protein
catalog :
B-245
more info or order :
citations: 2
| Reference |
|---|
image
image 1 :

Western blot analysis of purified proteins:Recombinant human proBDNF protein(#B-257) (lanes 1 and 4)Recombinant human BDNF proDomain protein(#B-245) (lanes 2 and 5)Recombinant human BDNF protein(#B-250) (lanes 3 and 6) - 1-3. Guinea pig Anti-proBDNF Antibody (#AGP-032) (1:280)4-6. Guinea pig Anti-BDNF Antibody (#AGP-021) (1:280)proBDNF is recognized both by Anti-proBDNF and Anti-BDNF antibodies as a monomer at ~ 26 kDa.BDNF proDomain is recognized by Anti-proBDNF but not by Anti-BDNF antibody at ~ 12.4 kDa.BDNF is recognized by Anti-BDNF but not by Anti-proBDNF antibody as a monomer at ~ 13.5 kDa.
image 2 :

Alomone Labs FPTQ inhibits mGluR1 mediated Ca2+mobilization in U2OS cells. - Dose response of normalized inhibition of human mGluR1 mediated L-Glutamate evoked Ca2+mobilization byFPTQ(#F-185) showing complete inhibition at 10 M. hmGluR1-expressing cells were loaded with Ca2+-sensitive dye incubated with a range of concentrations of FPTQ and stimulated by 15 M L-Glutamate (EC80). Changes in intracellular Ca2+following stimulation were detected as changes in maximum relative fluorescence (RLU) using FLIPRTETRA?.
image 3 :

product information
cat :
B-245
SKU :
B-245_0.1 mg
Product Name :
Recombinant human BDNF proDomain protein
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Western blot
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeated freeze-thaw cycles may result in loss of activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Recombinant, E. coli
Gene ID :
NGFR,NTRK2,SORT1,SORCS2
Product Page - Scientific background :
BDNF regulates neuronal survival, differentiation, and synaptic plasticity. It affects the release of excitatory neurotransmitters and has been found to affect cardiovascular development and function.1 Like many other neurotrophins, BDNF is a cleavage product of the BDNF precursor, proBDNF. This precursor may be cleaved by various proteases, intracellularly by furin and extracellularly by several proteases including prohormone convertases, plasminogen activator, MMP-3 and MMP-7 in vitro.2,3Two different trans-membrane receptor proteins mediate BDNF and proBDNF signal transduction: the TrkB, and the pan-neurotrophic receptor p75NTR.4 ProBDNF has been demonstrated to induce TrkB phosphorylation in vitro and to bind p75NTR and sortilin to promote apoptosis.5,6In many cases, the full prodomain region derived from the protein precursor has biological functions, for instance; the prodomain of the transforming growth factor β (TGFβ) affects the dimerization and folding as well as the activity of the mature proteins via non-covalent association. The propeptide of the bone morphogenetic proteins BMP-4 and BMP-7 regulates the diffusion and distribution of these growth factors within the extracellular matrix.7,8 The prodomain region of the BDNF precursor plays an important role in regulating its intracellular trafficking to secretory pathways.9 However, the role of the full BDNF-prodomain, which is a product of proteolytic cleavage of proBDNF, is not clearly understood. Furthermore, binding competition studies suggest that binding sites for BDNF prodomain are located in the tunnel of the ten-bladed b-propeller domain of sortilin.10
Supplier :
Alomone Labs
Long Description :
Human Brain-Derived Neurotrophic Factor proDomain, Recombinant, E. coli
Short Description :
Human Brain-Derived Neurotrophic Factor proDomain, Recombinant, E. coli
MW :
12.4 kDa
Effective Concentration :
10 - 100 ng/ml
Activity :
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1,2. BDNF supports the survival of many cell types3-8. proBDNF has been shown to be a pro-apoptotic ligand for sympathetic neurons9 expressing both p75 and sortilin, and to be involved in LTD10.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
MAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGL
TSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR-OH
TSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVM
LSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRR-OH
Is Toxin :
no
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
yes
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
