product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
α-Bungarotoxin
catalog :
B-100
more info or order :
citations: 10
| Reference |
|---|
image
image 1 :
Alomone Labs ?-Bungarotoxin inhibits muscle nAChR heterologously expressed inXenopusoocytes. - A. Time course of?-Bungarotoxin(#B-100) action onmuscle nicotinic ACh channel current (expressing ?1/?1/?/? nAChRs). Membrane potential was held at -80 mV and oocytes were constantly perfused with a solution containing 0.3 ?M PNU-120596. 10 ?M ACh was applied every 100 seconds in order to stimulate channel current. 10 nM(red trace) or 50 nM (green trace) ?-Bungarotoxinwere applied for 4.5 min each during the ACh application and inhibited channel current as indicated. B. Superimposed traces of muscle nAChR currents in the absence (control) and the presence of 10 nM(red trace) or 50 nM (green trace) ?-Bungarotoxin.
image 2 :
Alomone Labs AMG-9090 inhibits TRPA1 channel currents in HEK-293 cells. - Dose-response curve of AMG-9090 (#A-300) inhibition of human TRPA1-mediated increase in intracellular Ca2+. Cells were loaded with Calcium 5 dye incubated for 10 min with AMG-9090 and stimulated by 1 M allyl isothiocyanate (EC80). Changes in intracellular Ca2+ following stimulation were detected as changes in maximum relative fluorescence (RFU). IC50was determined at 0.527 nM.
image 3 :
Alomone Labs ?-Bungarotoxin inhibits ?7 nicotinic ACh channels heterologously expressed inXenopusoocytes. - Time course of ?7 nicotinic ACh channel current recording. Membrane potential was held at -60 mV and constantly perfused with a solution containing 10 mM Ca2+and 1 ?M PNU-120596. 1 ?M ACh was applied for 2 seconds every 200 seconds in order to stimulate channel current. 50 nM?-Bungarotoxin (#B-100) was applied (green trace) during the ACh application and inhibited channel current.
product information
cat :
B-100
SKU :
B-100_0.5 mg
Product Name :
α-Bungarotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P60615
Accession Number :
https://www.uniprot.org/uniprotkb/P60615/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Bungarus multicinctus (Many-banded krait)
Source :
Natural protein
Gene ID :
CHRNA1,CHRNA10,CHRNA7,CHRNA9,CHRNB1,GABRA1,GABRA2,GABRA4,GABRA5,GABRB2,GABRB3,GABRG2
Product Page - Scientific background :
α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1.α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2.The toxin is selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 µM)3,4.α-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR β3 subunit. In particular, α-Bungarotoxin blocks GABAARs that contain interfaces between adjacent β3 subunits5.
Supplier :
Alomone Labs
Target :
α7, α1/β1/γ/δ nAChR, GABA(A) receptor subtypes
Long Description :
A Potent Antagonist of α7 and Muscle nAChR and GABA(A) Receptor Subtypes
Short Description :
A Potent Antagonist of α7 and Muscle nAChR and GABA(A) Receptor Subtypes
MW :
7984 Da
Synonyms :
Long neurotoxin 1, α-Bgtx, α-BuTX
Modifications :
Disulfide bonds between: Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys59 and Cys60-Cys65
Molecular formula :
C338H529N97O105S11
Effective Concentration :
1 nM - 3 μM
Activity :
α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 μM)1,2. The toxin also blocks GABA(A) receptor subtypes3.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
CAS No :
11032-79-4
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKV
VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG-OH
VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
Cited Application :
Electrophysiology
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments