α-Bungarotoxin-Biotin | Alomone Labs B-100-B product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

α-Bungarotoxin-Biotin

catalog :

B-100-B

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs ?-Bungarotoxin-Biotin inhibits muscle nAChR channels heterologously expressed inXenopusoocytes. - A. Time course of muscle nAChR (?1/?1/?/?) current recording. Membrane potential was held at -80 mV and stimulated by perfused with a solution containing 100 M ACh and 3 ?M PNU-120596 every 100 sec. 200 nM?-Bungarotoxin-Biotin(#B-100-B) was applied (green) during the ACh application for 5.5 min and inhibited channel current as indicated. B. Superimposed examples of muscle nAChR current in the absence (black) and presence (green) of 200 nM ?-Bungarotoxin-Biotin (taken from the experiment in A).

image 2 :

Bungarotoxin binding sites co-localize with GABAergic neurons expressing parvalbumin in mouse hippocampal CA1 region. - A. Free floating mouse brain sections were incubated with?-Bungarotoxin-Biotin(#B-100-B) (1:10000) followed by streptavidin-Alexa 488 (green). B. Same sections were stained with anti-parvalbumin followed by goat anti-mouse labeled with Texas red isothiocyanate (TRITC). C. Merge of A and B demonstrates sites of colocalization (vertical arrows) confirming reports that a subset of hippocampal interneurons express nAChR ?7. DAPI is used as the counterstain.

product information

cat :

B-100-B

SKU :

B-100-B_10 mcg

Product Name :

α-Bungarotoxin-Biotin

Group Type :

Non Antibodies

Product Type :

Proteins

Applications :

Electrophysiology, Immunofluorescence, Indirect flow cytometry

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water to high-micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.

Origin :

Bungarus multicinctus (Many-banded krait)

Source :

Modified natural protein

Gene ID :

CHRNA1,CHRNA10,CHRNA7,CHRNA9,CHRNB1,GABRA1,GABRA2,GABRA4,GABRA5,GABRB2,GABRB3,GABRG2

Product Page - Scientific background :

α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1.α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2.The toxin is selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 µM)3,4.α-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR β3 subunit. In particular, α-Bungarotoxin blocks GABAARs that contain interfaces between adjacent β3 subunits5.

Supplier :

Alomone Labs

Target :

α7, α1/β1/γ/δ nAChR, GABA(A) receptor subtypes

Long Description :

A Biotinylated Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites

Short Description :

A Biotinylated Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites

MW :

~9030 Da

Synonyms :

Long neurotoxin 1, α-Bgtx, α-BuTX

Modifications :

Disulfide bonds between: Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys59 and Cys60-Cys65 LC-Biotin

Effective Concentration :

1 - 3 μM

Activity :

α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 μM)1,2. The toxin also blocks GABA(A) receptor subtypes3.

Storage of solutions :

Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day.

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKV
VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage