α-Bungarotoxin-ATTO Fluor-488 | Alomone Labs B-100-AG product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

α-Bungarotoxin-ATTO Fluor-488

catalog :

B-100-AG

more info or order :

Alomone Labs product webpage

citations: 7

Reference
Asante E, Hummel D, Gurung S, Kassim Y, Al Shakarji N, Palaniappan K, et al. Defective Neuronal Positioning Correlates With Aberrant Motor Circuit Function in Zebrafish. Front Neural Circuits. 2021;15:690475 pubmed publisher
Embregts C, Begeman L, Voesenek C, Martina B, Koopmans M, Kuiken T, et al. Street RABV Induces the Cholinergic Anti-inflammatory Pathway in Human Monocyte-Derived Macrophages by Binding to nAChr α7. Front Immunol. 2021;12:622516 pubmed publisher
Li B, Chen L, Gu Y. Stability of motor endplates is greater in the biceps than in the interossei in a rat model of obstetric brachial plexus palsy. Neural Regen Res. 2020;15:1678-1685 pubmed publisher
Ionescu A, Gradus T, Altman T, Maimon R, Saraf Avraham N, Geva M, et al. Targeting the Sigma-1 Receptor via Pridopidine Ameliorates Central Features of ALS Pathology in a SOD1G93A Model. Cell Death Dis. 2019;10:210 pubmed publisher
Zhou Q, Wang Y, Zhang J, Shao Y, Li S, Wang Y, et al. Fingerprint analysis of Huolingshengji Formula and its neuroprotective effects in SOD1G93A mouse model of amyotrophic lateral sclerosis. Sci Rep. 2018;8:1668 pubmed publisher
SHEETS L. Excessive activation of ionotropic glutamate receptors induces apoptotic hair-cell death independent of afferent and efferent innervation. Sci Rep. 2017;7:41102 pubmed publisher
Lenzi J, Pagani F, De Santis R, Limatola C, Bozzoni I, Di Angelantonio S, et al. Differentiation of control and ALS mutant human iPSCs into functional skeletal muscle cells, a tool for the study of neuromuscolar diseases. Stem Cell Res. 2016;17:140-7 pubmed publisher

image

image 1 :

Alomone Labs ?-Bungarotoxin-ATTO-488 inhibits ?7 nAChR heterologously expressed inXenopusoocytes. - A. Time course of ?7 nAChR current recording. Membrane potential was held at -60 mV and constantly perfused with a solution containing 3 ?M PNU-120596. 1 mM ACh was applied for 2 seconds every 90 seconds in order to stimulate the channel?s current. 200 nM?-Bungarotoxin-ATTO-488(#B-100-AG) was applied (green) during the ACh application and inhibited channel current. B. Superimposed examples of ?7 nicotinic ACh current in the absence (black) and presence (green) of 200 nM ?-Bungarotoxin-ATTO-488 (taken from the experiment in A).

image 2 :

Alomone Labs ?-Bungarotoxin-ATTO-488 in whole mount staining of mouse Gastrocnemius muscle. - Whole mount staining of mouse Gastrocnemius muscle stained with the neuromuscular junction marker?-Bungarotoxin-ATTO-488(#B-100-AG)(green) at 1:50 (A) and 1:100 (B) ratios.The images were taken using Nikon Epifluorescence microscopy at X100 magnification and are a kind gift from Dr. Eran Perlsson Dept. of Physiology and Pharmacology Tel-Aviv University.

image 3 :

Alomone Labs VU0529331 activates homomeric GIRK2 (Kir3.2) channels expressed in Xenopus oocytes. - Representative time course of GIRK2 (Kir3.2) current measured in continuously applied high K+-containing bath solution (top dotted line) and activated by 30 M VU0529331 (#V-155) as indicated at a holding potential of -80 mV.

product information

cat :

B-100-AG

SKU :

B-100-AG_0.1 mg

Product Name :

α-Bungarotoxin-ATTO Fluor-488

Group Type :

Non Antibodies

Product Type :

Proteins

Applications :

Electrophysiology, Fluorescence staining, Direct flow cytometry

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.

Origin :

Bungarus multicinctus (Many-banded krait)

Source :

Modified natural protein

Gene ID :

CHRNA1,CHRNA10,CHRNA7,CHRNA9,CHRNB1,GABRA1,GABRA2,GABRA4,GABRA5,GABRB2,GABRB3,GABRG2

Product Page - Scientific background :

α-Bungarotoxin isoform A31 is a 74 amino acid peptidyl toxin isolated from the venom of the banded krait snake, Bungarus multicinctus1.α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs) with an IC50 of 3.5 x 10-10 M, thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission2.The toxin is selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 µM)3,4.α-Bungarotoxin also binds to and blocks a subset of GABAA receptors (GABAARs) that contain the GABAAR β3 subunit. In particular, α-Bungarotoxin blocks GABAARs that contain interfaces between adjacent β3 subunits5.

Supplier :

Alomone Labs

Target :

α7, α1/β1/γ/δ nAChR, GABA(A) receptor subtypes

Long Description :

A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites

Short Description :

A Fluorescent Conjugate for Sensitive Detection of Neuromuscular Junctions, GABA(A) Receptors, nAChRs, and α-Bungarotoxin Binding Sites

MW :

~9140 Da

Synonyms :

Long neurotoxin 1, α-Bgtx, α-BuTX

Modifications :

Disulfide bonds between: Cys3-Cys23, Cys16-Cys44, Cys29-Cys33, Cys48-Cys59 and Cys60-Cys65 ATTO Fluor-488

Effective Concentration :

1 - 3 μM

Activity :

α-Bungarotoxin blocks postsynaptic neuromuscular transmission via competitive inhibition of nicotinic ACh receptors (nAChRs), thereby preventing the depolarizing action on postsynaptic membranes and blocking neuromuscular transmission. Selective for α7 receptors (IC50 value of 1.6 nM) and α3/β4 receptors (IC50 value of >3 μM)1,2. The toxin also blocks GABA(A) receptor subtypes3.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKV
VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

Cited Application :

Electrophysiology

more info or order :

Alomone Labs product webpage