Anti-Aquaporin 4 (AQP4) (249-323) Antibody | Alomone Labs AQP-004 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-Aquaporin 4 (AQP4) (249-323) Antibody

catalog :

AQP-004

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - free floating section

more info or order :

Alomone Labs product webpage

citations: 21

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - free floating section; mouse; 1:200	Guo Y, Wang D, Qiao T, Yang C, Su Q, Gao G, et al. A Single Injection of Recombinant Adeno-Associated Virus into the Lumbar Cistern Delivers Transgene Expression Throughout the Whole Spinal Cord. Mol Neurobiol. 2016;53:3235-3248 pubmed publisher
	Van Bergen T, Hu T, Little K, De Groef L, Moons L, Stitt A, et al. Targeting Plasma Kallikrein With a Novel Bicyclic Peptide Inhibitor (THR-149) Reduces Retinal Thickening in a Diabetic Rat Model. Invest Ophthalmol Vis Sci. 2021;62:18 pubmed publisher
	Wang T, Zhang C, Xie H, Jiang M, Tian H, Lu L, et al. Anti-VEGF therapy prevents Müller intracellular edema by decreasing VEGF-A in diabetic retinopathy. Eye Vis (Lond). 2021;8:13 pubmed publisher
	Hasegawa K, Yamaguchi Y, Tanaka M. Differential roles of VPS and RAAS in water homeostasis and a risk for kidney dysfunction in rats undergoing rapid fasting/dehydration with regular exercise. Physiol Rep. 2021;9:e14670 pubmed publisher
	Padmashri R, Ren B, Oldham B, Jung Y, Gough R, Dunaevsky A. Modeling human-specific interlaminar astrocytes in the mouse cerebral cortex. J Comp Neurol. 2021;529:802-810 pubmed publisher
	Laszczyk A, Higashi A, Patel S, Johnson C, Soofi A, Abraham S, et al. Pax2 and Pax8 Proteins Regulate Urea Transporters and Aquaporins to Control Urine Concentration in the Adult Kidney. J Am Soc Nephrol. 2020;31:1212-1225 pubmed publisher
	Toft Bertelsen T, Yarishkin O, Redmon S, Phuong T, Krizaj D, MacAulay N. Volume sensing in the transient receptor potential vanilloid 4 ion channel is cell type-specific and mediated by an N-terminal volume-sensing domain. J Biol Chem. 2019;294:18421-18434 pubmed publisher
	Park H, Choi S, Kong M, Kang T. Dysfunction of 67-kDa Laminin Receptor Disrupts BBB Integrity via Impaired Dystrophin/AQP4 Complex and p38 MAPK/VEGF Activation Following Status Epilepticus. Front Cell Neurosci. 2019;13:236 pubmed publisher
	Murali S, Aroankins T, Moeller H, Fenton R. The Deubiquitylase USP4 Interacts with the Water Channel AQP2 to Modulate Its Apical Membrane Accumulation and Cellular Abundance. Cells. 2019;8: pubmed publisher
	Krueger M, Mages B, Hobusch C, Michalski D. Endothelial edema precedes blood-brain barrier breakdown in early time points after experimental focal cerebral ischemia. Acta Neuropathol Commun. 2019;7:17 pubmed publisher
	Rocchio F, Tapella L, Manfredi M, Chisari M, Ronco F, Ruffinatti F, et al. Gene expression, proteome and calcium signaling alterations in immortalized hippocampal astrocytes from an Alzheimer's disease mouse model. Cell Death Dis. 2019;10:24 pubmed publisher
	Hardt S, Valek L, Zeng Brouwers J, Wilken Schmitz A, Schaefer L, Tegeder I. Progranulin Deficient Mice Develop Nephrogenic Diabetes Insipidus. Aging Dis. 2018;9:817-830 pubmed publisher
	Mørch M, Sørensen S, Khorooshi R, Asgari N, Owens T. Selective localization of IgG from cerebrospinal fluid to brain parenchyma. J Neuroinflammation. 2018;15:110 pubmed publisher
	Bi C, Tham D, Perronnet C, Joshi B, Nabi I, Moukhles H. The Oxidative Stress-Induced Increase in the Membrane Expression of the Water-Permeable Channel Aquaporin-4 in Astrocytes Is Regulated by Caveolin-1 Phosphorylation. Front Cell Neurosci. 2017;11:412 pubmed publisher
	Ellman D, Isaksen T, Lund M, Dursun S, Wirenfeldt M, Jørgensen L, et al. The loss-of-function disease-mutation G301R in the Na+/K+-ATPase α2 isoform decreases lesion volume and improves functional outcome after acute spinal cord injury in mice. BMC Neurosci. 2017;18:66 pubmed publisher
	Zhang X, Wang D, Pan H, Sun B. Enhanced Expression of Markers for Astrocytes in the Brain of a Line of GFAP-TK Transgenic Mice. Front Neurosci. 2017;11:212 pubmed publisher
	Thuringer D, Chanteloup G, Boucher J, Pernet N, Boudesco C, Jego G, et al. Modulation of the inwardly rectifying potassium channel Kir4.1 by the pro-invasive miR-5096 in glioblastoma cells. Oncotarget. 2017;8:37681-37693 pubmed publisher
	Marangoni D, Yong Z, Kjellstrom S, Vijayasarathy C, A Sieving P, Bush R. Rearing Light Intensity Affects Inner Retinal Pathology in a Mouse Model of X-Linked Retinoschisis but Does Not Alter Gene Therapy Outcome. Invest Ophthalmol Vis Sci. 2017;58:1656-1664 pubmed publisher
	Toft Bertelsen T, Kri aj D, MacAulay N. When size matters: transient receptor potential vanilloid 4 channel as a volume-sensor rather than an osmo-sensor. J Physiol. 2017;595:3287-3302 pubmed publisher
	Tham D, Joshi B, Moukhles H. Aquaporin-4 Cell-Surface Expression and Turnover Are Regulated by Dystroglycan, Dynamin, and the Extracellular Matrix in Astrocytes. PLoS ONE. 2016;11:e0165439 pubmed publisher
	Vacca O, Charles Messance H, El Mathari B, Sene A, Barbe P, Fouquet S, et al. AAV-mediated gene therapy in Dystrophin-Dp71 deficient mouse leads to blood-retinal barrier restoration and oedema reabsorption. Hum Mol Genet. 2016;25:3070-3079 pubmed

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004), (1:1000).2. Anti-Aquaporin 4 (AQP4) (249-323) Antibody, preincubated with the control fusion protein (BLP-QP004).

image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-Aquaporin 4 (AQP4) (249-323)Antibody (#AQP-004)(1:1000).2.Anti-Aquaporin 4 (AQP4) (249-323) Antibody preincubated with the control fusion protein.

image 3 :

GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV corresponding to amino acid residues 249-323 of rat AQP4 (Accession P47863). Intracellular C-terminus.

product information

CAT :

AQP-004

SKU :

AQP-004-CF_0.2 ml

Product Name :

Anti-Aquaporin 4 (AQP4) (249-323) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P47863

Applications :

IC IF IFC IHC WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-QP004

Homology :

Mouse - 73/75 amino acid residues identical; bovine - 71/75 amino acid residues identical; human - 69/75 amino acid residues identical; rabbit - 64/75 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rat

Sequence :

corresponding to amino acid residues 249-323 of rat AQP4
EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQV
ETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV,
GST fusion protein with the sequence

Product Page - Scientific background :

Aquaporin 4 (AQP-4) belongs to a family of membrane proteins that allow passage of water and certain solutes through biological membranes. The family is composed of 13 members (AQP-0 to AQP-12).The aquaporins can be divided into two functional groups based on their permeability characteristics: the aquaporins that are only permeated by water and the aquaglyceroporins that are permeated by water and other small solutes such as glycerol. AQP-4 together with AQP-1, AQP-2 and AQP-5 belong to the first group1. Little is known about the function of the two newest members, AQP-11 and AQP-12.The proteins present a conserved structure of six transmembrane domains with intracellular N- and C-termini. The functional channel is a tetramer but each subunit has a separate pore and therefore the functional channel unit, contains four pores1.AQP-4 is the major membrane water channel in the central nervous system. The channel is expressed in astrocyte foot processes in direct contact with capillary vessels in the brain suggesting a role in water transport under normal and pathological conditions. Indeed, transgenic mice lacking AQP-4 have reduced brain swelling and improved neurological outcome following water intoxication and focal cerebral ischemia. In contrast, brain swelling and clinical outcome are worse in AQP-4-null mice in models of vasogenic (fluid leak) edema caused by freeze-injury and brain tumor, probably due to impaired AQP-4-dependent brain water clearance2.In addition, it has been recently shown that neuromyelitis optica (NMO), an inflammatory demyelinating disease that selectively affects optic nerves and spinal cord, is caused by the development of an autoantibody directed against AQP-43.

Applications may also work in :

IC IF IFC IHC WB

Supplier :

Alomone Labs

Target :

WCH4, Mercurial-insensitive water channel

Short Description :

A Rabbit Polyclonal Antibody to Aquaporin 4 (249-323) Channel

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope located at the intracellular C-terminal domain of rat AQP4. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004) can be used in western blot, immunocytochemical, immunohistochemical and indirect flow cytometry applications. It recognizes the Aquaporin 4 channel from rat, mouse and human samples.

Negative Control :

BLP-QP004

Positive Control :

Synonyms :

WCH4, Mercurial-insensitive water channel

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

AQP4

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

IP IHC ICC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:1000

more info or order :

Alomone Labs product webpage