product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Anti-SAP102 Antibody
catalog :
APZ-003
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse
application :
western blot, immunohistochemistry
more info or order :
image
image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-SAP102 Antibody (#APZ-003), (1:400).2. Anti-SAP102 Antibody, preincubated with the control fusion protein antigen.
image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-SAP102 Antibody(#APZ-003) (1:400).2. Anti-SAP102 Antibody preincubated with the control fusion protein antigen.
image 3 :

Alomone Labs GYKI 47409 (BDZ-g) inhibits GluA1 channels expressed in Xenopus oocytes. - Representative time course of GluA1 current activated by a continuous application (top dotted line) of 5 M(S)-AMPA(#A-267) and inhibited by 1 M and 10 M GYKI 47409 (BDZ-g) (#G-245) as indicated (bars) at a holding potential of -80 mV.
product information
CAT :
APZ-003
SKU :
APZ-003-CF_0.2 ml
Product Name :
Anti-SAP102 Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
Q92796
Applications :
IHC WB
Reactivity :
Mouse
Host :
Rabbit
Blocking Peptide :
BLP-PZ003
Homology :
Rat, mouse - 26/32 amino acid residues identical
Formulation :
PBS pH7.4
isotype :
Rabbit IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
N-terminal domain
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Human
Sequence :
GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102
Product Page - Scientific background :
SAP-102 (also known as DLG3) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.SAP-102 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2. Moreover, mutations in the SAP102 gene have been linked with a form of mental retardation3.
Applications may also work in :
IHC WB
Supplier :
Alomone Labs
Target :
Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG
Short Description :
A Rabbit Polyclonal Antibody to SAP-102
Long Description :
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope located at the N-terminal region of the human SAP-102. Anti-SAP102 Antibody (#APZ-003) can be used in western blot and immunohistochemistry applications, and has been designed to recognize SAP-102 from rat, mouse and human samples.
Negative Control :
BLP-PZ003
Positive Control :
NA
Synonyms :
Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
DLG3
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
Contact Alomone for information
Application Dilutions: Western blot wb :
1:400
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments
