Anti-PSD-93 Antibody | Alomone Labs APZ-002 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-PSD-93 Antibody

catalog :

APZ-002

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 3

Reference
Arenas A, Cuadros M, Andrades Á, Garcia D, Coira I, Rodriguez M, et al. LncRNA DLG2-AS1 as a Novel Biomarker in Lung Adenocarcinoma. Cancers (Basel). 2020;12: pubmed publisher
Giralt A, Brito V, Pardo M, Rubio S, Marion Poll L, Martín Ibáñez R, et al. Helios modulates the maturation of a CA1 neuronal subpopulation required for spatial memory formation. Exp Neurol. 2020;323:113095 pubmed publisher
Shukla A, Beroun A, Panopoulou M, Neumann P, Grant S, Olive M, et al. Calcium-permeable AMPA receptors and silent synapses in cocaine-conditioned place preference. EMBO J. 2017;36:458-474 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-PSD-93 Antibody (#APZ-002), (1:1000).2. Anti-PSD-93 Antibody, preincubated with PSD-93 Blocking Peptide (#BLP-PZ002).

image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-PSD-93Antibody (#APZ-002) (1:1000).2.Anti-PSD-93 Antibody preincubated with the control fusion protein antigen.

product information

CAT :

APZ-002

SKU :

APZ-002-CF_0.2 ml

Product Name :

Anti-PSD-93 Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

Q63622

Applications :

IC IF IHC IP WB

Reactivity :

Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PZ002

Homology :

Human - 42/44 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Between PDZ2 and PDZ3 domains.

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rat

Sequence :

corresponding to amino acid residues 336-379 of rat Chapsyn-110
VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFL
LSTPY,
GST fusion protein with the sequence

Product Page - Scientific background :

Chapsyn 110 (also known as PSD-93 and DLG2) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs Large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.Indeed, Chapsyn 110 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2.

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Discs large homolog 2, Dlg2, Chapsyn-110

Short Description :

A Rabbit Polyclonal Antibody to PSD-93

Long Description :

Anti-PSD-93 Antibody (#APZ-002) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize PSD-93 from rat, mouse, and human samples.

Negative Control :

BLP-PZ002

Positive Control :

Synonyms :

Discs large homolog 2, Dlg2, Chapsyn-110

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

DLG2

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

Affinity purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:1000

more info or order :

Alomone Labs product webpage