product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Anti-KCNH2 (HERG) Antibody
catalog :
APC-062
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
more info or order :
citations: 9
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
image
image 1 :

Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells: - 1. Anti-KCNH2 (HERG) Antibody (#APC-062), (1:400).2. Anti-KCNH2 (HERG) Antibody, preincubated with KCNH2/HERG Blocking Peptide (#BLP-PC062).
image 2 :

GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS corresponding to amino acid residues 1106-1159 of humanKV11.1 (HERG) (AccessionQ12809). Intracellular C-terminus.
image 3 :

Expression of KV11.1 (HERG) in HEK-293 transfectedcells - Immunocytochemical staining of fixed and permeabilized KV11.1 transfectedHEK-293 cells. Cells were stained withAnti-KCNH2 (HERG) Antibody(#APC-062) followed bygoat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the KV11.1. Arrows indicate cells that do not expressthe channel.
product information
CAT :
APC-062
SKU :
APC-062-CF_0.2 ml
Product Name :
Anti-KCNH2 (HERG) Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
Q12809
Applications :
IC IF IHC IP WB
Reactivity :
Human Rat Mouse
Host :
Rabbit
Blocking Peptide :
BLP-PC062
Homology :
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical
Formulation :
PBS pH7.4
isotype :
Rabbit IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
Intracellular, C-terminus
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Human
Sequence :
corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGA
LTSQPLHRHGSDPGS,
GST fusion protein with the sequence
DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGA
LTSQPLHRHGSDPGS,
GST fusion protein with the sequence
Product Page - Scientific background :
The KV11.1 (HERG) channel is a member of the ether-a-go-go (EAG) subfamily of voltage-dependent K+ channels that includes the related proteins KV11.2 and KV11.3 (erg2 and erg3). KV11.1 possesses the signature structure of the voltage-dependent K+ channels: six membrane-spanning domains and intracellular N- and C-termini.The KV11.1 current is characterized by strong inward rectification with slow activation and very rapid inactivation kinetics. The channel is expressed in the brain and heart (where it underlies the IKr current) and has a central role in mediating repolarization of action potentials.1,2Mutations in the KV11.1 channel cause inherited long QT syndrome (LQTS) or abnormalities in the repolarization of the heart that are associated with life-threatening arrhythmias and sudden death. All the identified KV11.1 mutations produce loss of function of the channel via several cellular mechanisms ranging from alterations of gating properties, alterations of channel permeability/selectivity and alterations in intracellular channel trafficking that decreases the number of channels that reach the cell membrane.1,2 Recently, drug-induced forms of LQTS have been reported for a wide range of non-cardiac drugs including antihistamines, psychoactive agents and antimicrobials. All these drugs potently block the KV11.1 channel as an unintended side effect, prompting regulatory drug agencies to issue recommendations for the testing of new drugs for their potential KV11.1 blocking effect.In addition, KV11.1 expression was found to be upregulated in several tumor cell lines of different histogenesis, suggesting that it confers the cells some advantage in cell proliferation. Indeed, in several studies it has been shown that inhibition of the KV11.1 current leads to a decrease in tumor cell proliferation.3Several toxins from scorpion venoms are potent blockers (affecting the channels in the nanomolar range) of KV11.1 channels. Among these the most potent and selective are Ergtoxin-1 (16 nM)4 and BeKM-1 (3 nM).5 In addition, the methanesulfonanilide class III antiarrhythmic agent E-4031 also blocks KV11.1 channel in the nanomolar range (7.7 nM).6
Applications may also work in :
IC IF IHC IP WB
Supplier :
Alomone Labs
Target :
KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1
Short Description :
A Rabbit Polyclonal Antibody to KV11.1 Channel
Long Description :
Alomone Labs is pleased to offer a highly specific antibody directed against an intracellular epitope of the human KV11.1 channel. Anti-KCNH2 (HERG) Antibody (#APC-062) can be used in western blot, immunoprecipitation, immunohistochemical and immunocytochemical applications. It has been designed to recognize KV11.1 from human, rat, and mouse samples.
Negative Control :
BLP-PC062
Positive Control :
NA
Synonyms :
KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
KCNH2
AB Specifictiy :
The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
Cited Application :
ICC
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
Contact Alomone for information
Application Dilutions: Western blot wb :
1:400
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments
