Anti-KCNH2 (HERG) Antibody | Alomone Labs APC-062 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-KCNH2 (HERG) Antibody

catalog :

APC-062

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 9

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; 1:400; fig 3	Eng G, Lee B, Protas L, Gagliardi M, Brown K, Kass R, et al. Autonomous beating rate adaptation in human stem cell-derived cardiomyocytes. Nat Commun. 2016;7:10312 pubmed publisher
	Song L, Bekdash R, Morikawa K, Quejada J, Klein A, Aina Badejo D, et al. Sigma non-opioid receptor 1 is a potential therapeutic target for long QT syndrome. Nat Cardiovasc Res. 2022;1:142-156 pubmed publisher
	Kabakov A, Sengun E, Lu Y, Roder K, Bronk P, Baggett B, et al. Three-Week-Old Rabbit Ventricular Cardiomyocytes as a Novel System to Study Cardiac Excitation and EC Coupling. Front Physiol. 2021;12:672360 pubmed publisher
	Della Flora Nunes G, Wilson E, Marziali L, Hurley E, Silvestri N, He B, et al. Prohibitin 1 is essential to preserve mitochondria and myelin integrity in Schwann cells. Nat Commun. 2021;12:3285 pubmed publisher
	Vaddi D, Piao L, Khan S, Wang N, Prabhakar N, Nanduri J. Hypoxia induced hERG trafficking defect linked to cell cycle arrest in SH-SY5Y cells. PLoS ONE. 2019;14:e0215905 pubmed publisher
	Zhang D, Hu X, Li J, Liu J, Baks Te Bulte L, Wiersma M, et al. DNA damage-induced PARP1 activation confers cardiomyocyte dysfunction through NAD+ depletion in experimental atrial fibrillation. Nat Commun. 2019;10:1307 pubmed publisher
	McGonigal R, Barrie J, Yao D, McLaughlin M, Cunningham M, Rowan E, et al. Glial Sulfatides and Neuronal Complex Gangliosides Are Functionally Interdependent in Maintaining Myelinating Axon Integrity. J Neurosci. 2019;39:63-77 pubmed publisher
	Ji Y, Takanari H, Qile M, Nalos L, Houtman M, Romunde F, et al. Class III antiarrhythmic drugs amiodarone and dronedarone impair KIR 2.1 backward trafficking. J Cell Mol Med. 2017;21:2514-2523 pubmed publisher
	Hantouche C, Williamson B, Valinsky W, Solomon J, Shrier A, Young J. Bag1 Co-chaperone Promotes TRC8 E3 Ligase-dependent Degradation of Misfolded Human Ether a Go-Go-related Gene (hERG) Potassium Channels. J Biol Chem. 2017;292:2287-2300 pubmed publisher

image

image 1 :

Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells: - 1. Anti-KCNH2 (HERG) Antibody (#APC-062), (1:400).2. Anti-KCNH2 (HERG) Antibody, preincubated with KCNH2/HERG Blocking Peptide (#BLP-PC062).

image 2 :

GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS corresponding to amino acid residues 1106-1159 of humanKV11.1 (HERG) (AccessionQ12809). Intracellular C-terminus.

image 3 :

Expression of KV11.1 (HERG) in HEK-293 transfectedcells - Immunocytochemical staining of fixed and permeabilized KV11.1 transfectedHEK-293 cells. Cells were stained withAnti-KCNH2 (HERG) Antibody(#APC-062) followed bygoat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the KV11.1. Arrows indicate cells that do not expressthe channel.

product information

CAT :

APC-062

SKU :

APC-062-CF_0.2 ml

Product Name :

Anti-KCNH2 (HERG) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

Q12809

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC062

Homology :

Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Human

Sequence :

corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG)
DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGA
LTSQPLHRHGSDPGS,
GST fusion protein with the sequence

Product Page - Scientific background :

The KV11.1 (HERG) channel is a member of the ether-a-go-go (EAG) subfamily of voltage-dependent K+ channels that includes the related proteins KV11.2 and KV11.3 (erg2 and erg3). KV11.1 possesses the signature structure of the voltage-dependent K+ channels: six membrane-spanning domains and intracellular N- and C-termini.The KV11.1 current is characterized by strong inward rectification with slow activation and very rapid inactivation kinetics. The channel is expressed in the brain and heart (where it underlies the IKr current) and has a central role in mediating repolarization of action potentials.1,2Mutations in the KV11.1 channel cause inherited long QT syndrome (LQTS) or abnormalities in the repolarization of the heart that are associated with life-threatening arrhythmias and sudden death. All the identified KV11.1 mutations produce loss of function of the channel via several cellular mechanisms ranging from alterations of gating properties, alterations of channel permeability/selectivity and alterations in intracellular channel trafficking that decreases the number of channels that reach the cell membrane.1,2 Recently, drug-induced forms of LQTS have been reported for a wide range of non-cardiac drugs including antihistamines, psychoactive agents and antimicrobials. All these drugs potently block the KV11.1 channel as an unintended side effect, prompting regulatory drug agencies to issue recommendations for the testing of new drugs for their potential KV11.1 blocking effect.In addition, KV11.1 expression was found to be upregulated in several tumor cell lines of different histogenesis, suggesting that it confers the cells some advantage in cell proliferation. Indeed, in several studies it has been shown that inhibition of the KV11.1 current leads to a decrease in tumor cell proliferation.3Several toxins from scorpion venoms are potent blockers (affecting the channels in the nanomolar range) of KV11.1 channels. Among these the most potent and selective are Ergtoxin-1 (16 nM)4 and BeKM-1 (3 nM).5 In addition, the methanesulfonanilide class III antiarrhythmic agent E-4031 also blocks KV11.1 channel in the nanomolar range (7.7 nM).6

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1

Short Description :

A Rabbit Polyclonal Antibody to KV11.1 Channel

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against an intracellular epitope of the human KV11.1 channel. Anti-KCNH2 (HERG) Antibody (#APC-062) can be used in western blot, immunoprecipitation, immunohistochemical and immunocytochemical applications. It has been designed to recognize KV11.1 from human, rat, and mouse samples.

Negative Control :

BLP-PC062

Positive Control :

Synonyms :

KV11.1, Potassium voltage-gated channel subfamily H member 2, Ether-a-go-go-related channel 1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNH2

AB Specifictiy :

The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

Cited Application :

ICC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:400

more info or order :

Alomone Labs product webpage