Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody | Alomone Labs APC-021 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody

catalog :

APC-021

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 25

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; mouse; 1:100; fig 3 western blot; mouse; 1:1000; fig 1	Li Y, Hu H, Butterworth M, Tian J, Zhu M, O Neil R. Expression of a Diverse Array of Ca2+-Activated K+ Channels (SK1/3, IK1, BK) that Functionally Couple to the Mechanosensitive TRPV4 Channel in the Collecting Duct System of Kidney. PLoS ONE. 2016;11:e0155006 pubmed publisher
immunocytochemistry; human; 2 ug/ml; fig 2 immunoprecipitation; mouse; fig 1	Singh H, Li M, Hall L, Chen S, Sukur S, Lu R, et al. MaxiK channel interactome reveals its interaction with GABA transporter 3 and heat shock protein 60 in the mammalian brain. Neuroscience. 2016;317:76-107 pubmed publisher
	Ohya S, Kajikuri J, Endo K, Kito H, Elboray E, Suzuki T. Ca2+ -activated K+ channel KCa 1.1 as a therapeutic target to overcome chemoresistance in three-dimensional sarcoma spheroid models. Cancer Sci. 2021;112:3769-3783 pubmed publisher
	Sung C, Chen M, Lin Y, Lin Y, Lin Y, Yang S, et al. Urinary Extracellular Vesicles for Renal Tubular Transporters Expression in Patients With Gitelman Syndrome. Front Med (Lausanne). 2021;8:679171 pubmed publisher
	Fu X, An Y, Wang H, Li P, Lin J, Yuan J, et al. Deficiency of Klc2 Induces Low-Frequency Sensorineural Hearing Loss in C57BL/6 J Mice and Human. Mol Neurobiol. 2021;: pubmed publisher
	Xu X, Li Y, Wu Y, Xu Y, Weng R, Wang C, et al. Upregulation of spinal ASIC1 by miR-485 mediates enterodynia in adult offspring rats with prenatal maternal stress. CNS Neurosci Ther. 2021;27:244-255 pubmed publisher
	Bai J, Xue N, Lawal O, Nyati A, Santos Sacchi J, Navaratnam D. Calcium-induced calcium release in proximity to hair cell BK channels revealed by PKA activation. Physiol Rep. 2020;8:e14449 pubmed publisher
	Chen S, Feng X, Chen X, Zhuang Z, Xiao J, Fu H, et al. 14-3-3γ, a novel regulator of the large-conductance Ca2+-activated K+ channel. Am J Physiol Renal Physiol. 2020;319:F52-F62 pubmed publisher
	Zhao H, Xue Q, Li C, Wang Q, Han S, Zhou Y, et al. Upregulation of Beta4 subunit of BKCa channels in the anterior cingulate cortex contributes to mechanical allodynia associated anxiety-like behaviors. Mol Brain. 2020;13:22 pubmed publisher
	Yang X, Wang G, Cao T, Zhang L, Ma Y, Jiang S, et al. Large-conductance calcium-activated potassium channels mediate lipopolysaccharide-induced activation of murine microglia. J Biol Chem. 2019;294:12921-12932 pubmed publisher
	Barone C, Douma S, Reijntjes D, Browe B, K ppl C, Klump G, et al. Altered cochlear innervation in developing and mature naked and Damaraland mole rats. J Comp Neurol. 2019;527:2302-2316 pubmed publisher
	Goswami S, Ponnalagu D, Hussain A, Shah K, Karekar P, Gururaja Rao S, et al. Expression and Activation of BKCa Channels in Mice Protects Against Ischemia-Reperfusion Injury of Isolated Hearts by Modulating Mitochondrial Function. Front Cardiovasc Med. 2018;5:194 pubmed publisher
	Wolter S, Möhrle D, Schmidt H, Pfeiffer S, Zelle D, Eckert P, et al. GC-B Deficient Mice With Axon Bifurcation Loss Exhibit Compromised Auditory Processing. Front Neural Circuits. 2018;12:65 pubmed publisher
	Li Y, Hu H, O Neil R. Caveolae facilitate TRPV4-mediated Ca2+ signaling and the hierarchical activation of Ca2+-activated K+ channels in K+-secreting renal collecting duct cells. Am J Physiol Renal Physiol. 2018;315:F1626-F1636 pubmed publisher
	Pritchard H, Pires P, Yamasaki E, Thakore P, Earley S. Nanoscale remodeling of ryanodine receptor cluster size underlies cerebral microvascular dysfunction in Duchenne muscular dystrophy. Proc Natl Acad Sci U S A. 2018;115:E9745-E9752 pubmed publisher
	Lu T, Chai Q, Jiao G, Wang X, Sun X, Furuseth J, et al. Downregulation of BK channel function and protein expression in coronary arteriolar smooth muscle cells of type 2 diabetic patients. Cardiovasc Res. 2019;115:145-153 pubmed publisher
	Pritchard H, Gonzales A, Pires P, Drumm B, Ko E, Sanders K, et al. Microtubule structures underlying the sarcoplasmic reticulum support peripheral coupling sites to regulate smooth muscle contractility. Sci Signal. 2017;10: pubmed publisher
	Zhang Y, Zhang Z, Xiao S, Tien J, Le S, Le T, et al. Inferior Olivary TMEM16B Mediates Cerebellar Motor Learning. Neuron. 2017;95:1103-1111.e4 pubmed publisher
	Baker D, Pryce G, Visintin C, Sisay S, Bondarenko A, Vanessa Ho W, et al. Big conductance calcium-activated potassium channel openers control spasticity without sedation. Br J Pharmacol. 2017;174:2662-2681 pubmed publisher
	Zaman T, de Oliveira C, Smoka M, Narla C, Poulter M, Schmid S. BK Channels Mediate Synaptic Plasticity Underlying Habituation in Rats. J Neurosci. 2017;37:4540-4551 pubmed publisher
	Nystoriak M, Nieves Cintrón M, Patriarchi T, Buonarati O, Prada M, Morotti S, et al. Ser1928 phosphorylation by PKA stimulates the L-type Ca2+ channel CaV1.2 and vasoconstriction during acute hyperglycemia and diabetes. Sci Signal. 2017;10: pubmed publisher
	Ren J, Xin F, Liu P, Zhao H, Zhang S, Han P, et al. Role of BKCa in Stretch-Induced Relaxation of Colonic Smooth Muscle. Biomed Res Int. 2016;2016:9497041 pubmed publisher
	Velázquez Marrero C, Burgos A, García J, Palacio S, Marrero H, Bernardo A, et al. Alcohol Regulates BK Surface Expression via Wnt/?-Catenin Signaling. J Neurosci. 2016;36:10625-10639 pubmed
	Perry M, Rajendran V, MacLennan K, Sandle G. Segmental differences in upregulated apical potassium channels in mammalian colon during potassium adaptation. Am J Physiol Gastrointest Liver Physiol. 2016;311:G785-G793 pubmed publisher
	Zhang J, Li M, Zhang Z, Zhu R, Olcese R, Stefani E, et al. The mitochondrial BKCa channel cardiac interactome reveals BKCa association with the mitochondrial import receptor subunit Tom22, and the adenine nucleotide translocator. Mitochondrion. 2017;33:84-101 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021), (1:200).2. Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody, preincubated with KCNMA1 (KCa1.1) (1097-1196) Blocking Peptide (#BLP-PC021).

image 2 :

SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVEDEC corresponding to residues 1097-1196 of mouse KCNMA1variant 2 (AccessionQ08460-2). Intracellular C-terminus.

image 3 :

Expression of KCa1.1 in mouse SAN cells. - Immunocytochemical staining of mouse sinoatrial cells (SANCs) using Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021). BK channel expression (red) overlaps with that of HCN4 (green). No detection of KCa1.1 was observed with the secondary antibody.Adapted from Lai M.H. et al. (2014) with permission of the American Physiological Society.

product information

CAT :

APC-021

SKU :

APC-021-CF_0.2 ml

Product Name :

Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

Q08460-2

Applications :

IC IF IHC IP WB

Reactivity :

Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC021

Homology :

Chicken - 91/99 amino acid residues identical; rabbit - 88/99 amino acid residues identical; turtle - 87/99 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Mouse

Sequence :

corresponding to residues 1097-1196 of mouse KCNMA1 variant 2
SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQ
NATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMAN
QINQYKSTSSLIPPIREVEDEC,

Product Page - Scientific background :

The KCa1.1 channel (also known as KCNMA1, BKCa, Maxi K+ or slo) is part of a structurally diverse group of K+ channels that are activated by an increase in intracellular Ca2+. KCa1.1 shows a large single channel conductance when recorded electrophysiologically and hence its name. It differs from the rest of the subfamily members in that it can be activated by both an increase in intracellular Ca2+ and by membrane depolarization. In addition, the KCa1.1 channel structurally differs from the other Ca2+-dependent K+ channels. While the latter group has a topology that resembles that of the voltage-dependent K+ channels, the KCa1.1 channel has an extracellular N-terminus domain as well as an additional transmembrane domain.KCa1.1 is expressed in virtually all cell types where it causes hyperpolarization and helps to connect intracellular Ca2+ signaling pathways and membrane excitability.Indeed, KCa1.1 channels play a crucial role in smooth muscle contractility, neuronal spike shaping and neurotransmitter release.

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Large conductance calcium-activated potassium channel subfamily M subunit alpha-1, BKCa alpha, Maxi K+, Slo1

Short Description :

A Rabbit Polyclonal Antibody to KCNMA1 (KCa1.1) Channel

Long Description :

Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021) is a highly specific antibody directed against an epitope of the mouse protein. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KCNMA1 from human, mouse, and rat samples.

Negative Control :

BLP-PC021

Positive Control :

Synonyms :

Large conductance calcium-activated potassium channel subfamily M subunit alpha-1, BKCa alpha, Maxi K+, Slo1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNMA1

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

IP IHC ICC IFC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage