product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody
catalog :
APC-021-GP
clonality :
polyclonal
host :
guinea-pigs
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse, rat
application :
western blot
more info or order :
citations: 1
image
image 1 :

Western blot analysis of rat bladder lysate: - 1. Guinea pig Anti-KCNMA1 (KCa1.1) (1097–1096) Antibody (#APC-021-GP), (1:200).2. Guinea pig Anti-KCNMA1 (KCa1.1) (1097–1096) Antibody, preincubated with KCNMA1/KCa1.1 (1097-1196) Blocking Peptide (#BLP-PC021).
product information
CAT :
APC-021-GP
SKU :
APC-021-GP-CF_0.2 ml
Product Name :
Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
Q08460-2
Applications :
WB
Reactivity :
Human Rat Mouse
Host :
Guinea Pig
Blocking Peptide :
BLP-PC021
Homology :
Mouse - 21/21 amino acid residues identical to the canonical sequence (Accession Q08460); rat - 20/21 amino acid residues identical to the canonical sequence (Accession Q62976); human - 19/21 amino acid residues identical to the canonical sequence (Accession Q12791)
Formulation :
PBS pH7.4
isotype :
Guinea pig total IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
Intracellular, C-terminus
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Mouse
Sequence :
corresponding to residues 1097-1196 of mouse KCNMA1 variant 2
SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQ
NATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMAN
QINQYKSTSSLIPPIREVEDEC,
SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQ
NATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMAN
QINQYKSTSSLIPPIREVEDEC,
Product Page - Scientific background :
High conductance voltage and Ca2+-activated K+ channels (also known as BK or Slo1 channels) are a family of K+ channels involved in various physiological processes including neuronal excitability and smooth muscle contraction.KCa1.1 channel, also known as KCNMA1, is a member of the BK family and like other BK channels it is comprised of four identical subunits. Each unit consists of seven transmembrane segments and a large intracellular C-terminus. Transmembrane segments S1 to S4 form the channel's voltage sensor; S5, S6 and the intervening amino acids form the pore and selectivity filter. The C-terminus forms a large cytoplasmic domain. This large domain accounts for two-thirds of the entire channel and is believed to contain the domain for Ca2+ binding. Two tandem C-terminal regulator of K+ conductance (RCK) domains from each of four channel subunits form a gating ring at the intracellular membrane surface. A sequence of amino acids that is known as the Ca2+ bowl, and is located within the second of the tandem RCK domains, creates four Ca2+ binding sites on the outer perimeter of the gating ring between RCK domains.KCa1.1 is regulated, both by membrane depolarization and increased intracellular Ca2+ levels which cause the channel to open. This causes subsequent membrane hyperpolarization that closes voltage- and Ca2+-gated channels thus making KCa1.1 a negative feedback regulator for electrical excitation1.KCa1.1 is implicated in the pathogenesis of several diseases. Elevated levels of KCa1.1 mRNA are detected in malignant pleural mesothelioma patients compared with control patients2. Also, blocking KCa1.1 reduces the symptoms of fibroblast-like synoviocytes in rheumatoid arthritis animal models.
Applications may also work in :
WB
Supplier :
Alomone Labs
Target :
Large conductance calcium-activated potassium channel subfamily M subunit alpha-1, BKCa alpha, Maxi K+, Slo1
Short Description :
A Guinea Pig Polyclonal Antibody to KCNMA1 (KCa1.1) Channel
Long Description :
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of the mouse KCNMA1 channel. Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021-GP, formerly AGP-014), raised in guinea pigs, can be used in western blot, immunoprecipitation, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize KCNMA1 from human, mouse and rat samples. The antigen used to immunize guinea pigs is the same as Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021) raised in rabbit. Our line of guinea pig antibodies enables more flexibility with our products such as multiplex staining studies, immunoprecipitation, etc.
Negative Control :
BLP-PC021
Positive Control :
NA
Synonyms :
Large conductance calcium-activated potassium channel subfamily M subunit alpha-1, BKCa alpha, Maxi K+, Slo1
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
KCNMA1
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
Cited Application :
ICC IHC
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
Contact Alomone for information
Application Dilutions: Western blot wb :
1:200
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments