antibody

Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody

APC-021-GP

polyclonal

guinea-pigs

nonconjugated

NA

human, mouse, rat

APC-021-GP-CF_0.2 ml

Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody

Antibodies

Antibodies

Polyclonal

Q08460-2

WB

Human Rat Mouse

Guinea Pig

BLP-PC021

Mouse - 21/21 amino acid residues identical to the canonical sequence (Accession Q08460); rat - 20/21 amino acid residues identical to the canonical sequence (Accession Q62976); human - 19/21 amino acid residues identical to the canonical sequence (Accession Q12791)

PBS pH7.4

Guinea pig total IgG

Confirmed by DNA sequence and SDS-PAGE

0.2 ml double distilled water (DDW).

1 mg/ml

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

No Preservative

Intracellular, C-terminus

Unconjugated

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

Mouse

corresponding to residues 1097-1196 of mouse KCNMA1 variant 2
SHSSHSSQSSSKKSSSVHSIPSTANRPNRPKSRESRDKQ
NATRMTRMGQAEKKWFTDEPDNAYPRNIQIKPMSTHMAN
QINQYKSTSSLIPPIREVEDEC,

High conductance voltage and Ca2+-activated K+ channels (also known as BK or Slo1 channels) are a family of K+ channels involved in various physiological processes including neuronal excitability and smooth muscle contraction.KCa1.1 channel, also known as KCNMA1, is a member of the BK family and like other BK channels it is comprised of four identical subunits. Each unit consists of seven transmembrane segments and a large intracellular C-terminus. Transmembrane segments S1 to S4 form the channel's voltage sensor; S5, S6 and the intervening amino acids form the pore and selectivity filter. The C-terminus forms a large cytoplasmic domain. This large domain accounts for two-thirds of the entire channel and is believed to contain the domain for Ca2+ binding. Two tandem C-terminal regulator of K+ conductance (RCK) domains from each of four channel subunits form a gating ring at the intracellular membrane surface. A sequence of amino acids that is known as the Ca2+ bowl, and is located within the second of the tandem RCK domains, creates four Ca2+ binding sites on the outer perimeter of the gating ring between RCK domains.KCa1.1 is regulated, both by membrane depolarization and increased intracellular Ca2+ levels which cause the channel to open. This causes subsequent membrane hyperpolarization that closes voltage- and Ca2+-gated channels thus making KCa1.1 a negative feedback regulator for electrical excitation1.KCa1.1 is implicated in the pathogenesis of several diseases. Elevated levels of KCa1.1 mRNA are detected in malignant pleural mesothelioma patients compared with control patients2. Also, blocking KCa1.1 reduces the symptoms of fibroblast-like synoviocytes in rheumatoid arthritis animal models.

WB

Alomone Labs

Large conductance calcium-activated potassium channel subfamily M subunit alpha-1, BKCa alpha, Maxi K+, Slo1

A Guinea Pig Polyclonal Antibody to KCNMA1 (KCa1.1) Channel

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of the mouse KCNMA1 channel. Guinea pig Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021-GP, formerly AGP-014), raised in guinea pigs, can be used in western blot, immunoprecipitation, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize KCNMA1 from human, mouse and rat samples. The antigen used to immunize guinea pigs is the same as Anti-KCNMA1 (KCa1.1) (1097-1196) Antibody (#APC-021) raised in rabbit. Our line of guinea pig antibodies enables more flexibility with our products such as multiplex staining studies, immunoprecipitation, etc.

BLP-PC021

NA

Large conductance calcium-activated potassium channel subfamily M subunit alpha-1, BKCa alpha, Maxi K+, Slo1

1-2 Business Days

Israel/IL

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

KCNMA1

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Contact Alomone Labs for technical support and product customization

H- Human, M- Mouse, R- Rat

No

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

41116161

ICC IHC

NA

Western blot analysis

3 µg fusion protein per 1 µg antibody

Contact Alomone for information

1:200