product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Anti-KV1.2 (KCNA2) Antibody
catalog :
APC-010
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry
more info or order :
citations: 7
Reference
Stulajterova R, Medvecky L, Giretova M, Sopcak T, Luptakova L, Bures R, et al. Characterization of Tetracalcium Phosphate/Monetite Biocement Modified by Magnesium Pyrophosphate. Materials (Basel). 2022;15: pubmed publisher
Liu Y, Zhang L, Dong L, Song Q, Guo P, Wang Y, et al. Hesperetin improves diabetic coronary arterial vasomotor responsiveness by upregulating myocyte voltage-gated K+ channels. Exp Ther Med. 2020;20:486-494 pubmed publisher
Mao Q, Wu S, Gu X, Du S, Mo K, Sun L, et al. DNMT3a-triggered downregulation of K2p 1.1 gene in primary sensory neurons contributes to paclitaxel-induced neuropathic pain. Int J Cancer. 2019;145:2122-2134 pubmed publisher
Mo K, Wu S, Gu X, Xiong M, Cai W, Atianjoh F, et al. MBD1 Contributes to the Genesis of Acute Pain and Neuropathic Pain by Epigenetic Silencing of Oprm1 and Kcna2 Genes in Primary Sensory Neurons. J Neurosci. 2018;38:9883-9899 pubmed publisher
Fu L, Lv Y, Zhong Y, He Q, Liu X, Du L. Tyrosine phosphorylation of Kv1.5 is upregulated in intrauterine growth retardation rats with exaggerated pulmonary hypertension. Braz J Med Biol Res. 2017;50:e6237 pubmed publisher
Vivekananda U, Novak P, Bello O, Korchev Y, Krishnakumar S, Volynski K, et al. Kv1.1 channelopathy abolishes presynaptic spike width modulation by subthreshold somatic depolarization. Proc Natl Acad Sci U S A. 2017;114:2395-2400 pubmed publisher
Wolff M, Czorlich P, Nagaraj C, Schnöbel Ehehalt R, Li Y, Kwapiszewska G, et al. Amitriptyline and carbamazepine utilize voltage-gated ion channel suppression to impair excitability of sensory dorsal horn neurons in thin tissue slice: An in vitro study. Neurosci Res. 2016;109:16-27 pubmed publisher
image
image 1 :
Alomone Labs APC-010 image 1
Western blot analysis of rat brain membranes: - 1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200).2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
image 2 :
Alomone Labs APC-010 image 2
Multiplex staining of KV1.2 and KV1.1 in mouse cerebellum - Immunohistochemical staining of mouse perfusion-fixed frozen brain sections using Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:300) and Anti-KV1.1 (KCNA1) (extracellular)-ATTO Fluor-594 Antibody (#APC-161-AR), (1:100). A. KV1.2 staining, followed by donkey-anti-rabbit-Cy2 (green). B. KV1.1 staining (red). C. Merge of the two images suggests considerable co-localization in the pinceau structures (up-pointing arrows). KV1.1 also appears in blood vessels (down-pointing arrows), where no KV1.2 expression is observed.
image 3 :
Alomone Labs APC-010 image 3
Western blot analysisof rat brain membranes: - 1.Anti-KV1.2 (KCNA2)Antibody (#APC-010) (1:200).2. Anti-KV1.2 (KCNA2) Antibody preincubated with the negative control antigen.
product information
CAT :
APC-010
SKU :
APC-010-CF_0.2 ml
Product Name :
Anti-KV1.2 (KCNA2) Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
P63142
Applications :
IC IF IHC WB
Reactivity :
Human Rat Mouse
Host :
Rabbit
Blocking Peptide :
BLP-PC010
Homology :
Mouse, dog, human, - identical
Formulation :
PBS pH7.4
isotype :
Rabbit IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
Intracellular, C-terminus
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Rat
Sequence :
corresponding to amino acid residues 417-499 of rat KV1.2
SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLA
NTNYVNITKMLTDV,
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK
Product Page - Scientific background :
KV1.2 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.2 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.2 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and cardiac and smooth muscle tissue as well as in retina and pancreas.2 The crystal structure of KV1.2 was recently solved shading light on the structure of a mammalian voltage dependent channel.3 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.KV1.2 channels are sensitive to high doses of TEA (560 mM) and low doses of 4-AP (0.59 mM), the "classical" non-selective potassium channel blockers.Several venomous toxins from snakes, scorpions and honey bee are potent blockers (affecting the channels in the nanomolar range) of KV1.2 channels. Among these, the most potent and selective are α-Dendrotoxin (1-12 nM), Dendrotoxin-I (0.13 nM), Maurotoxin (0.1-0.8 nM), Hongotoxin-1 (0.17 nM), Margatoxin (0.16-0.65 nM), Tityustoxin Kα (0.21 nM) and MCD peptide (10-400 nM).4
Applications may also work in :
IC IF IHC WB
Supplier :
Alomone Labs
Target :
Potassium voltage-gated channel subfamily A member 2, RBK2
Short Description :
A Rabbit Polyclonal Antibody to KV1.2 (KCNA2) Channel
Long Description :
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (#APC-010) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.
Negative Control :
BLP-PC010
Positive Control :
NA
Synonyms :
Potassium voltage-gated channel subfamily A member 2, RBK2
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
KCNA2
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
Cited Application :
IP IHC ICC
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
1:300
Application Dilutions: Western blot wb :
1:200
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel