Anti-KV1.1 (KCNA1) Antibody | Alomone Labs APC-009 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-KV1.1 (KCNA1) Antibody

catalog :

APC-009

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 10

Reference
Stulajterova R, Medvecky L, Giretova M, Sopcak T, Luptakova L, Bures R, et al. Characterization of Tetracalcium Phosphate/Monetite Biocement Modified by Magnesium Pyrophosphate. Materials (Basel). 2022;15: pubmed publisher
Kirtay M, Sell J, Marx C, Haselmann H, Ceanga M, Zhou Z, et al. ATR regulates neuronal activity by modulating presynaptic firing. Nat Commun. 2021;12:4067 pubmed publisher
Mayadali Ü, Fleuriet J, MUSTARI M, Straka H, Horn A. Transmitter and ion channel profiles of neurons in the primate abducens and trochlear nuclei. Brain Struct Funct. 2021;226:2125-2151 pubmed publisher
Catignas K, Frick L, Pellegatta M, Hurley E, Kolb Z, Addabbo K, et al. αV integrins in Schwann cells promote attachment to axons, but are dispensable in vivo. Glia. 2020;: pubmed publisher
Poveda C, Valero M, Pernìa M, Alvarado J, Ryugo D, Merchán M, et al. Expression and Localization of Kv1.1 and Kv3.1b Potassium Channels in the Cochlear Nucleus and Inferior Colliculus after Long-Term Auditory Deafferentation. Brain Sci. 2020;10: pubmed publisher
Reijntjes D, Lee J, Park S, Schubert N, van Tuinen M, Vijayakumar S, et al. Sodium-activated potassium channels shape peripheral auditory function and activity of the primary auditory neurons in mice. Sci Rep. 2019;9:2573 pubmed publisher
McGonigal R, Barrie J, Yao D, McLaughlin M, Cunningham M, Rowan E, et al. Glial Sulfatides and Neuronal Complex Gangliosides Are Functionally Interdependent in Maintaining Myelinating Axon Integrity. J Neurosci. 2019;39:63-77 pubmed publisher
Luo F, Zhang J, Burke K, Romito Digiacomo R, Miller R, Yang Y. Oligodendrocyte-specific loss of Cdk5 disrupts the architecture of nodes of Ranvier as well as learning and memory. Exp Neurol. 2018;306:92-104 pubmed publisher
Poitelon Y, Matafora V, Silvestri N, Zambroni D, McGarry C, Serghany N, et al. A dual role for Integrin α6β4 in modulating hereditary neuropathy with liability to pressure palsies. J Neurochem. 2018;145:245-257 pubmed publisher
Hu L, Wang B, Zhang Y. Serotonin 5-HT6 receptors affect cognition in a mouse model of Alzheimer's disease by regulating cilia function. Alzheimers Res Ther. 2017;9:76 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-KV1.1 (KCNA1) Antibody (#APC-009), (1:200).2. Anti-KV1.1 (KCNA1) Antibody, preincubated with Kv1.1/KCNA1 Blocking Peptide (#BLP-PC009).

image 2 :

GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV corresponding to amino acid residues 416-495 of mouse KV1.1 (AccessionP16388). Intracellular C-terminus.

image 3 :

Cell surface detection of TREM2 in live intact mouse J774 macrophage cells: - ___ Cells.___ Cells + goat-anti-rabbit-FITC.___ Cells +Anti-TREM2 (extracellular) Antibody (#ANR-018) (2.5 g) + goat-anti-rabbit-FITC.

product information

CAT :

APC-009

SKU :

APC-009-CF_0.2 ml

Product Name :

Anti-KV1.1 (KCNA1) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P16388

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC009

Homology :

Rat - 78/80 amino acid residues identical; human - 76/80 amino acid residues identical; Xenopus Laevis - 70/80 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Mouse

Sequence :

corresponding to amino acid residues 416-495 of mouse KV1.1
SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYR
QANIRTGNCTTADQNCVNKSKLLTDV,
GST fusion protein with the sequence HRETEGEEQAQLLHV

Product Page - Scientific background :

KV1.1 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker-related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function. The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.3KV1.1 channels are sensitive to low doses of TEA (0.3 mM) and 4-AP (0.29 mM), the "classical" non-selective potassium channel blockers.Several venomous toxins from snakes, scorpions and sea anemones are potent blockers (affecting the channels in the nanomolar range) of KV1.1 channels. Among these, the most potent and selective are α-Dendrotoxin (0.4-4 nM) and δ-Dendrotoxin (0.03-1.8 nM), Dendrotoxin-K (0.03 nM), Agitoxin-2 (0.044 nM) and Hongotoxin-1 (0.031 nM).4

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Potassium voltage-gated channel subfamily A member 1

Short Description :

A Rabbit Polyclonal Antibody to KV1.1 (KCNA1) Channel

Long Description :

Anti-KV1.1 (KCNA1) Antibody (#APC-009) is a highly specific antibody directed against an epitope of the mouse protein. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize KV1.1 from human, rat, and mouse samples.

Negative Control :

BLP-PC009

Positive Control :

Synonyms :

Potassium voltage-gated channel subfamily A member 1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNA1

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

Cited Application :

IHC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage