product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Anti-KV1.4 Antibody
catalog :
APC-007
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry
more info or order :
citations: 3
Reference
Stulajterova R, Medvecky L, Giretova M, Sopcak T, Luptakova L, Bures R, et al. Characterization of Tetracalcium Phosphate/Monetite Biocement Modified by Magnesium Pyrophosphate. Materials (Basel). 2022;15: pubmed publisher
Zhang W, Cao H, Li Y, Fu X, Zhang Y. Peripheral ablation of type III adenylyl cyclase induces hyperalgesia and eliminates KOR-mediated analgesia in mice. JCI Insight. 2022;7: pubmed publisher
Tylock K, Auerbach D, Tang Z, Thornton C, Dirksen R. Biophysical mechanisms for QRS- and QTc-interval prolongation in mice with cardiac expression of expanded CUG-repeat RNA. J Gen Physiol. 2020;152: pubmed publisher
image
image 1 :
Alomone Labs APC-007 image 1
Western blot analysis of rat brain membranes: - 1. Anti-KV1.4 Antibody (#APC-007), (1:200).2. Anti-KV1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007).
image 2 :
Alomone Labs APC-007 image 2
Western blot analysisof rat brain membranes: - 1.Anti-KV1.4Antibody (#APC-007) (1:200).2.Anti-KV1.4 Antibody preincubated with the control peptide antigen.
image 3 :
Alomone Labs APC-007 image 3
Western blot analysis of mouse BV-2 microglia (lanes 1 and 4) human U-87 MG glioblastoma (lanes 2 and 5) and human THP-1 monocytic leukemia (lanes 3 and 6)cell line lysates: - 1-3. Anti-TREM2 (extracellular) Antibody (#ANR-018) (1:200).4-6. Anti-TREM2 (extracellular) Antibody preincubated with the negative control antigen.
product information
CAT :
APC-007
SKU :
APC-007-CF_0.2 ml
Product Name :
Anti-KV1.4 Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
P15385
Applications :
IC IF IHC WB
Reactivity :
Human Rat Mouse
Host :
Rabbit
Blocking Peptide :
BLP-PC007
Homology :
Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical
Formulation :
PBS pH7.4
isotype :
Rabbit IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
Intracellular, C-terminus
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Rat
Sequence :
corresponding to amino acid residues 589-655 of rat KV1.4
PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGK
EEKCQGKGDDSETDKNNCSNAKAVETDV,
GST fusion protein with the sequence
Product Page - Scientific background :
KV1.4 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.4 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition, several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.4 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the pancreas.2 The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.KV1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the "classical" non-selective potassium channel blockers.Most venomous peptide toxins that affect other KV channels do not inhibit KV1.4. However, the sea anemone toxin Stichodactyla Toxin (ShK), which is more potent towards KV1.1 and KV1.3, is still a potent inhibitor of KV1.4 channels.3
Applications may also work in :
IC IF IHC WB
Supplier :
Alomone Labs
Target :
Potassium voltage-gated channel subfamily A member 4, KCNA4
Short Description :
A Rabbit Polyclonal Antibody to KV1.4 Channel
Long Description :
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rat KV1.4. Anti-KV1.4 Antibody (#APC-007) can be used in western blot, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.4 from human, rat and mouse samples.
Negative Control :
BLP-PC007
Positive Control :
NA
Synonyms :
Potassium voltage-gated channel subfamily A member 4, KCNA4
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
KCNA4
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
Contact Alomone for information
Application Dilutions: Western blot wb :
1:200
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel