product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Anti-KV1.6 (KCNA6) Antibody
catalog :
APC-003
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - frozen section
more info or order :
citations: 4
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - frozen section; mouse; fig 7
Manicam C, Staubitz J, Brochhausen C, Grus F, Pfeiffer N, Gericke A. The Gatekeepers in the Mouse Ophthalmic Artery: Endothelium-Dependent Mechanisms of Cholinergic Vasodilation. Sci Rep. 2016;6:20322 pubmed publisher
Stulajterova R, Medvecky L, Giretova M, Sopcak T, Luptakova L, Bures R, et al. Characterization of Tetracalcium Phosphate/Monetite Biocement Modified by Magnesium Pyrophosphate. Materials (Basel). 2022;15: pubmed publisher
Liu M, Liu H, Parthiban P, Kang G, Shi G, Feng F, et al. Inhibition of the unfolded protein response reduces arrhythmia risk after myocardial infarction. J Clin Invest. 2021;131: pubmed publisher
Vivekananda U, Novak P, Bello O, Korchev Y, Krishnakumar S, Volynski K, et al. Kv1.1 channelopathy abolishes presynaptic spike width modulation by subthreshold somatic depolarization. Proc Natl Acad Sci U S A. 2017;114:2395-2400 pubmed publisher
image
image 1 :
Alomone Labs APC-003 image 1
Western blot analysis of rat brain membranes: - 1. Anti-KV1.6 (KCNA6) Antibody (#APC-003), (1:200).2. Anti-KV1.6 (KCNA6) Antibody, preincubated with Kv1.6/KCNA6 Blocking Peptide (#BLP-PC003).
image 2 :
Alomone Labs APC-003 image 2
Western blot analysisof rat brain membranes: - 1.Anti-KV1.6 (KCNA6) Antibody(#APC-003) (1:200).2. Anti-KV1.6 (KCNA6) Antibody preincubated with the control peptide antigen.
product information
CAT :
APC-003
SKU :
APC-003-CF_0.2 ml
Product Name :
Anti-KV1.6 (KCNA6) Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
P17659
Applications :
IC IF IHC WB
Reactivity :
Human Rat Mouse
Host :
Rabbit
Blocking Peptide :
BLP-PC003
Homology :
Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical
Formulation :
PBS pH7.4
isotype :
Rabbit IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
Intracellular, C-terminus
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Rat
Sequence :
corresponding to amino acid residues 463-530 of rat KV1.6
NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPD
FAEASRERRSSYLPTPHRAYAEKRMLTEV,
GST fusion protein with the sequence
Product Page - Scientific background :
KV1.6 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.6 was first cloned from human brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.6 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and other supporting cells in the brain, in cardiac and smooth muscle tissue as well as in ovary and testis2 and its activity influences the membrane potential and excitability of expressing cells.KV1.6 channels are sensitive to low doses of TEA (7 mM) and high doses of 4-AP (1.5 mM), the "classical" non-selective potassium channel blockers.Several toxins from snakes, scorpions and sea anemones venoms are potent blockers (affecting the channels in the nanomolar range) of KV1.6 channels. Among these the most potent and selective are α-Dendrotoxin ((9-25 nM) and δ-Dendrotoxin (23 nM), Agitoxin-2 (0.036 nM), Hongotoxin-1 (6 nM), Margatoxin (5 nM) and Stichodactyla Toxin (0.16 nM).3
Applications may also work in :
IC IF IHC WB
Supplier :
Alomone Labs
Target :
Potassium voltage-gated channel subfamily A member 6, RCK2, Human brain potassium channel 2, HBK2
Short Description :
A Rabbit Polyclonal Antibody to KV1.6 (KCNA6) Channel
Long Description :
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of the rat KV1.6 channel. Anti-KV1.6 (KCNA6) Antibody (#APC-003) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize KV1.6 from human, rat and mouse samples.
Negative Control :
BLP-PC003
Positive Control :
NA
Synonyms :
Potassium voltage-gated channel subfamily A member 6, RCK2, Human brain potassium channel 2, HBK2
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
KCNA6
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
Cited Application :
IHC
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
Contact Alomone for information
Application Dilutions: Western blot wb :
1:200
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel