Anti-KV1.6 (KCNA6) Antibody | Alomone Labs APC-003 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-KV1.6 (KCNA6) Antibody

catalog :

APC-003

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - frozen section

more info or order :

Alomone Labs product webpage

citations: 4

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - frozen section; mouse; fig 7	Manicam C, Staubitz J, Brochhausen C, Grus F, Pfeiffer N, Gericke A. The Gatekeepers in the Mouse Ophthalmic Artery: Endothelium-Dependent Mechanisms of Cholinergic Vasodilation. Sci Rep. 2016;6:20322 pubmed publisher
	Stulajterova R, Medvecky L, Giretova M, Sopcak T, Luptakova L, Bures R, et al. Characterization of Tetracalcium Phosphate/Monetite Biocement Modified by Magnesium Pyrophosphate. Materials (Basel). 2022;15: pubmed publisher
	Liu M, Liu H, Parthiban P, Kang G, Shi G, Feng F, et al. Inhibition of the unfolded protein response reduces arrhythmia risk after myocardial infarction. J Clin Invest. 2021;131: pubmed publisher
	Vivekananda U, Novak P, Bello O, Korchev Y, Krishnakumar S, Volynski K, et al. Kv1.1 channelopathy abolishes presynaptic spike width modulation by subthreshold somatic depolarization. Proc Natl Acad Sci U S A. 2017;114:2395-2400 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-KV1.6 (KCNA6) Antibody (#APC-003), (1:200).2. Anti-KV1.6 (KCNA6) Antibody, preincubated with Kv1.6/KCNA6 Blocking Peptide (#BLP-PC003).

image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-KV1.6 (KCNA6) Antibody(#APC-003) (1:200).2. Anti-KV1.6 (KCNA6) Antibody preincubated with the control peptide antigen.

product information

CAT :

APC-003

SKU :

APC-003-CF_0.2 ml

Product Name :

Anti-KV1.6 (KCNA6) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P17659

Applications :

IC IF IHC WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC003

Homology :

Mouse - 67/68 amino acid residues identical; human - 63/68 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rat

Sequence :

corresponding to amino acid residues 463-530 of rat KV1.6
NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPD
FAEASRERRSSYLPTPHRAYAEKRMLTEV,
GST fusion protein with the sequence

Product Page - Scientific background :

KV1.6 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.6 was first cloned from human brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.6 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2The channel is expressed in neurons and other supporting cells in the brain, in cardiac and smooth muscle tissue as well as in ovary and testis2 and its activity influences the membrane potential and excitability of expressing cells.KV1.6 channels are sensitive to low doses of TEA (7 mM) and high doses of 4-AP (1.5 mM), the "classical" non-selective potassium channel blockers.Several toxins from snakes, scorpions and sea anemones venoms are potent blockers (affecting the channels in the nanomolar range) of KV1.6 channels. Among these the most potent and selective are α-Dendrotoxin ((9-25 nM) and δ-Dendrotoxin (23 nM), Agitoxin-2 (0.036 nM), Hongotoxin-1 (6 nM), Margatoxin (5 nM) and Stichodactyla Toxin (0.16 nM).3

Applications may also work in :

IC IF IHC WB

Supplier :

Alomone Labs

Target :

Potassium voltage-gated channel subfamily A member 6, RCK2, Human brain potassium channel 2, HBK2

Short Description :

A Rabbit Polyclonal Antibody to KV1.6 (KCNA6) Channel

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of the rat KV1.6 channel. Anti-KV1.6 (KCNA6) Antibody (#APC-003) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize KV1.6 from human, rat and mouse samples.

Negative Control :

BLP-PC003

Positive Control :

Synonyms :

Potassium voltage-gated channel subfamily A member 6, RCK2, Human brain potassium channel 2, HBK2

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNA6

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

Cited Application :

IHC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage