Anti-KV1.3 (KCNA3) Antibody | Alomone Labs APC-002 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-KV1.3 (KCNA3) Antibody

catalog :

APC-002

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 13

Reference
Anton R, Ghenghea M, Ristoiu V, Gattlen C, Suter M, Cojocaru P, et al. Potassium Channels Kv1.3 and Kir2.1 But Not Kv1.5 Contribute to BV2 Cell Line and Primary Microglial Migration. Int J Mol Sci. 2021;22: pubmed publisher
Newton H, Gawali V, Chimote A, Lehn M, Palackdharry S, Hinrichs B, et al. PD1 blockade enhances K+ channel activity, Ca2+ signaling, and migratory ability in cytotoxic T lymphocytes of patients with head and neck cancer. J Immunother Cancer. 2020;8: pubmed publisher
Sarkar S, Nguyen H, Malovic E, Luo J, Langley M, Palanisamy B, et al. Kv1.3 modulates neuroinflammation and neurodegeneration in Parkinson's disease. J Clin Invest. 2020;130:4195-4212 pubmed publisher
Birkner K, Wasser B, Ruck T, Thalman C, Luchtman D, Pape K, et al. β1-integrin- and KV1.3 channel-dependent signaling stimulates glutamate release from Th17 cells. J Clin Invest. 2019;: pubmed publisher
Lowinus T, Heidel F, Bose T, Nimmagadda S, Schnöder T, Cammann C, et al. Memantine potentiates cytarabine-induced cell death of acute leukemia correlating with inhibition of Kv1.3 potassium channels, AKT and ERK1/2 signaling. Cell Commun Signal. 2019;17:5 pubmed publisher
Angelova D, Brown D. Model Senescent Microglia Induce Disease Related Changes in α-Synuclein Expression and Activity. Biomolecules. 2018;8: pubmed publisher
Chen Y, Nguyen H, Maezawa I, Jin L, Wulff H. Inhibition of the potassium channel Kv1.3 reduces infarction and inflammation in ischemic stroke. Ann Clin Transl Neurol. 2018;5:147-161 pubmed publisher
Rangaraju S, Raza S, Pennati A, Deng Q, Dammer E, Duong D, et al. A systems pharmacology-based approach to identify novel Kv1.3 channel-dependent mechanisms in microglial activation. J Neuroinflammation. 2017;14:128 pubmed publisher
Liu J, Xu E, Tu G, Liu H, Luo J, Xiong H. Methamphetamine potentiates HIV-1gp120-induced microglial neurotoxic activity by enhancing microglial outward K+ current. Mol Cell Neurosci. 2017;82:167-175 pubmed publisher
de la Cruz A, Vera Zambrano A, Peraza D, Valenzuela C, Zapata J, Perez Chacon G, et al. Fludarabine Inhibits KV1.3 Currents in Human B Lymphocytes. Front Pharmacol. 2017;8:177 pubmed publisher
Liu H, Liu J, Xu E, Tu G, Guo M, Liang S, et al. Human immunodeficiency virus protein Tat induces oligodendrocyte injury by enhancing outward K+ current conducted by KV1.3. Neurobiol Dis. 2017;97:1-10 pubmed publisher
Wolff M, Czorlich P, Nagaraj C, SchnÃ¶bel Ehehalt R, Li Y, Kwapiszewska G, et al. Amitriptyline and carbamazepine utilize voltage-gated ion channel suppression to impair excitability of sensory dorsal horn neurons in thin tissue slice: An in vitro study. Neurosci Res. 2016;109:16-27 pubmed publisher
Chen Y, Nguyen H, Maezawa I, Grössinger E, Garing A, Köhler R, et al. The potassium channel KCa3.1 constitutes a pharmacological target for neuroinflammation associated with ischemia/reperfusion stroke. J Cereb Blood Flow Metab. 2016;36:2146-2161 pubmed

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-KV1.3 (KCNA3) Antibody (#APC-002), (1:200).2. Anti-KV1.3 (KCNA3) Antibody, preincubated with Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002).

image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-KV1.3(KCNA3)Antibody (#APC-002) (1:200).2. Anti-KV1.3 (KCNA3) Antibody preincubated with the negative control antigen.

image 3 :

Cell surface detection of EAAT1 inlive intact human MEG-01 megakaryoblastic leukemia cells: - ___Cells.___Cells + Rabbit IgG isotype control-FITC.___Cells + Anti-EAAT1 (GLAST) (extracellular)-FITC Antibody(#AGC-021-F) (5 g).

product information

CAT :

APC-002

SKU :

APC-002-CF_0.2 ml

Product Name :

Anti-KV1.3 (KCNA3) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P22001

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC002

Homology :

Rat, rabbit, mouse - identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Human

Sequence :

corresponding to amino acid residues 523-575 of human KV1.3
TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNN
PNSCVNIKKIFTDV,
GST fusion protein with the sequence

Product Page - Scientific background :

KV1.3 belongs to the Shaker family of voltage-dependent K+ channels. The channel, encoded by KCNA3, is widely expressed in the brain, lung and osteoclasts and in several cell populations of hematopoietic origin. The prominence of KV1.3 channels in these cells (particularly in T lymphocytes) directed much research attention. It was found that KV1.3 is the main channel responsible for maintaining the resting potential in quiescent cells and regulating the Ca2+ signaling that is indispensable for normal T lymphocyte activation.1,2 Based on the central role of KV1.3 in regulating the initiation of an immune response, the channel has been recognized as a potential target for immunosuppressant drugs.1KV1.3 channels are potently inhibited by several venomous peptide toxins among them Charybdotoxin (2.6 nM), Noxiustoxin (1 nM), Kaliotoxin (0.65 nM), Margatoxin (0.05 nM), Agitoxin-1 (1.7 nM), Agitoxin-2 (0.004 nM), Hongotoxin-1 (0.09 nM) and Stichodactyla toxin (0.01 nM).3-7

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Potassium voltage-gated channel subfamily A member 3

Short Description :

A Rabbit Polyclonal Antibody to KV1.3 (KCNA3) Channel

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of human KV1.3. Anti-KV1.3 (KCNA3) Antibody (#APC-002) can be used in western blot, immunoprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize KV1.3 potassium channel from human, rat, and mouse samples.

Negative Control :

BLP-PC002

Positive Control :

Synonyms :

Potassium voltage-gated channel subfamily A member 3

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNA3

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

Cited Application :

IP IHC ICC IFC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage