Anti-KCNJ1 (Kir1.1) Antibody | Alomone Labs APC-001 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-KCNJ1 (Kir1.1) Antibody

catalog :

APC-001

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 7

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; 1:500; loading ...; fig 4b	Chan C, Wu S, Bao B, Li H, Lu T. MST3 Involvement in Na+ and K+ Homeostasis with Increasing Dietary Potassium Intake. Int J Mol Sci. 2021;22: pubmed publisher
western blot; mouse; loading ...; fig 4h	Yoshioka W, Kawaguchi T, Nishimura N, Akagi T, Fujisawa N, Yanagisawa H, et al. Polyuria-associated hydronephrosis induced by xenobiotic chemical exposure in mice. Am J Physiol Renal Physiol. 2016;311:F752-F762 pubmed publisher
	Sung C, Chen M, Lin Y, Lin Y, Lin Y, Yang S, et al. Urinary Extracellular Vesicles for Renal Tubular Transporters Expression in Patients With Gitelman Syndrome. Front Med (Lausanne). 2021;8:679171 pubmed publisher
	Guarascio D, Gonzalez Velandia K, Hernandez Clavijo A, Menini A, Pifferi S. Functional expression of TMEM16A in taste bud cells. J Physiol. 2021;599:3697-3714 pubmed publisher
	Banerjee A, Lu Y, Do K, Mize T, Wu X, Chen X, et al. Validation of Induced Microglia-Like Cells (iMG Cells) for Future Studies of Brain Diseases. Front Cell Neurosci. 2021;15:629279 pubmed publisher
	Chen J, Lo Y, Lin Y, Lin S, Huang C, Cheng C. WNK4 kinase is a physiological intracellular chloride sensor. Proc Natl Acad Sci U S A. 2019;: pubmed publisher
	Ding Y, Abiri A, Abiri P, Li S, Chang C, Baek K, et al. Integrating light-sheet imaging with virtual reality to recapitulate developmental cardiac mechanics. JCI Insight. 2017;2: pubmed publisher

image

image 1 :

Western blot analysis of rat kidney membranes: - 1. Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (1:200).2. Anti-KCNJ1 (Kir1.1) Antibody, preincubated with KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001).

image 2 :

Expression of KCNJ1 in rat kidney - Immunohistochemical staining of rat kidney sections using Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (left). There is strong staining (red) of tubular epithelial cells in distal tubes. Note that no staining is observed in proximal tubules (arrow). Counterstain of cell nuclei appears blue. A negative control is shown (right).

image 3 :

Expression of KCNJ1in rat kidney - Immunohistochemical staining of rat kidney sectionsusingAnti-KCNJ1 (Kir1.1)Antibody (#APC-001) (left).There is strong staining (red) of tubular epithelial cells in distal tubes.Note that no staining is observed in proximal tubules (arrow).Counterstain of cell nuclei appears blue. A negative control is shown (right).

product information

CAT :

APC-001

SKU :

APC-001-CF_0.2 ml

Product Name :

Anti-KCNJ1 (Kir1.1) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P35560

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC001

Homology :

Mouse - identical; human - 45/50 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rat

Sequence :

DDTQM, corresponding to amino acids 342-391 of rat KCNJ1
HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVL
SEVDET
GST fusion protein with the sequence

Product Page - Scientific background :

Kir1.1 (KCNJ1, ROMK1) was the first member of the family of inward rectifying K+ channels to be cloned.1 The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.The family's topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels, the functional unit for the Kir channel is composed of four subunits that can assemble as either homo or heterotetramers.Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.3As its original name indicates (ROMK1, Renal Outer Medullary K+ channel), Kir1.1 is strongly expressed in the kidney in the apical membrane of several kidney segments such as the thick ascending loop of Henle (TAL) and the cortical collecting duct (CCD). In addition, the channel is also expressed in the brain, mainly in the cortex and hippocampus.3Kir1.1 plays a key role in K+ recycling in the loop of Henle. Indeed, loss-of-function mutations in the Kir1.1 gene cause Bartter's syndrome type II, a recessive autosomal disease characterized by the impairment of K+ efflux and the subsequent inability of the NKCC2 transporter to continue NaCl uptake. This leads to a high salt concentration in the urine that induces osmotic diuresis and low plasma volume.2 Pharmacologically, the Kir1.1 channel can be inhibited by several general K+ channel blockers such as Tertiapin (#STT-250), however the scorpion toxin Lq2 (#RTL-550) specifically and potently inhibits Kir1.1 channels.4

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

ROMK1, ATP-sensitive inward rectifier potassium channel 1

Short Description :

A Rabbit Polyclonal Antibody to KCNJ1 (Kir1.1) Channel

Long Description :

Anti-KCNJ1 (Kir1.1) Antibody (#APC-001) is a highly specific antibody directed against an epitope of the rat potassium channel ROM-K. The antibody can be used in western blot, immunohistochemistry, immunocytochemistry, and immunoprecipitation applications. It has been designed to recognize ROMK1 from rat, mouse, and human samples.

Negative Control :

BLP-PC001

Positive Control :

Synonyms :

ROMK1, ATP-sensitive inward rectifier potassium channel 1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNJ1

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage