Anti-Syntaxin 1 Antibody | Alomone Labs ANR-002 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-Syntaxin 1 Antibody

catalog :

ANR-002

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry

more info or order :

Alomone Labs product webpage

citations: 4

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; rat; 1:200; loading ...; fig 2 western blot; rat; 1:40,000; loading ...; fig 1a	Hussain S, Ringsevjen H, Egbenya D, Skjervold T, Davanger S. SNARE Protein Syntaxin-1 Colocalizes Closely with NMDA Receptor Subunit NR2B in Postsynaptic Spines in the Hippocampus. Front Mol Neurosci. 2016;9:10 pubmed publisher
	Haytural H, Jordà Siquier T, Winblad B, Mulle C, Tjernberg L, Granholm A, et al. Distinctive alteration of presynaptic proteins in the outer molecular layer of the dentate gyrus in Alzheimer's disease. Brain Commun. 2021;3:fcab079 pubmed publisher
	Barthet G, Jordà Siquier T, Rumi Masante J, Bernadou F, Müller U, Mulle C. Presenilin-mediated cleavage of APP regulates synaptotagmin-7 and presynaptic plasticity. Nat Commun. 2018;9:4780 pubmed publisher
	Karkhanis A, Leach A, Yorgason J, Uneri A, Barth S, Niere F, et al. Chronic Social Isolation Stress during Peri-Adolescence Alters Presynaptic Dopamine Terminal Dynamics via Augmentation in Accumbal Dopamine Availability. ACS Chem Neurosci. 2019;10:2033-2044 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-Syntaxin 1 Antibody (ANR-002), (1:1000).2. Anti-Syntaxin 1 Antibody, preincubated with Syntaxin 1 Blocking Peptide (#BLP-NR002).

image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-Syntaxin 1Antibody (ANR-002) (1:1000).2.Anti-Syntaxin 1 Antibody preincubated with the control fusion protein antigen.

image 3 :

Peptide (C)DYTWNKDNWTFSP corresponding to amino acid residues 72 - 84 of human GPR65 (Accession Q8IYL9). 1st extracellular loop.

product information

CAT :

ANR-002

SKU :

ANR-002-CF_0.2 ml

Product Name :

Anti-Syntaxin 1 Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P32851

Applications :

IF IHC WB

Reactivity :

Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-NR002

Homology :

Human, mouse- 264/265 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, N-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rat

Sequence :

STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKK, corresponding to amino acid residues 1-265 of rat syntaxin 1A
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEE
IRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEEL
MSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRK
TQH
GST fusion protein with the sequence

Product Page - Scientific background :

Syntaxin 1 is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) protein superfamily. The family includes 36 members in humans and is characterized by the SNARE motif, an evolutionarily conserved stretch of 60-70 amino acids that are arranged in heptad repeats1,2.SNARE proteins are involved in exocytosis and intracellular vesicle trafficking and are essential for cell growth, hormone secretion and neurotransmission, processes that require rapid, targeted, and regulated membrane fusion1,2.SNAREs can be roughly divided into vesicular (v-SNAREs) and target (t-SNAREs) based on their distribution on the transport vesicle or target membrane respectively. Thus, assembly of cognate v-/t-SNAREs between two opposing membranes generates trans-SNARE complexes, which bring the lipid bilayers in close proximity and drive membrane fusion.Syntaxin 1, like most SNAREs, is a type IV membrane protein with a relatively large N-terminus containing the SNARE motif located in the cytoplasmic side and a transmembrane domain located close to the C-terminus that functions as an anchor1,2.Syntaxin 1 has been extensively studied for its role on neuronal and neuroendocrine cell exocytosis where it functions as the plasma membrane protein t-SNARE, which together with the vesicular v-SNARE protein VAMP and the membrane-associated SNAP-25 (synaptosome-associated protein 25 kDa), forms a trimeric, four-helical complex, which drives fusion of the two opposing bilayers1,2.Syntaxin 1 together with SNAP-25 is the target of the neurotoxin botulinum neurotoxin type C (BoNT/C) which following proteolytic degradation of the proteins causes inhibition of neurotransmitter release 3.

Applications may also work in :

IF IHC WB

Supplier :

Alomone Labs

Target :

STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1

Short Description :

A Rabbit Polyclonal Antibody to Syntaxin 1

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against the intracellular N-terminal domain of rat Syntaxin 1. Anti-Syntaxin 1 Antibody (#ANR-002) can be used in western blot and immunohistochemical applications, and was designed to recognize Syntaxin 1 from rat, mouse and human samples.

Negative Control :

BLP-NR002

Positive Control :

Synonyms :

STX1A, Synaptotagmin-associated 35 kDa protein, P35A, P35-1, Neuron-specific antigen HPC-1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

STX1A

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

Cited Application :

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:1000

more info or order :

Alomone Labs product webpage