Anti-CHRM2 Antibody | Alomone Labs AMR-002 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-CHRM2 Antibody

catalog :

AMR-002

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - frozen section

more info or order :

Alomone Labs product webpage

citations: 17

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - frozen section; rat; 1:200; fig 1	BraganÃ§a B, Oliveira Monteiro N, Ferreirinha F, Lima P, Faria M, Fontes Sousa A, et al. Ion Fluxes through KCa2 (SK) and Cav1 (L-type) Channels Contribute to Chronoselectivity of Adenosine A1 Receptor-Mediated Actions in Spontaneously Beating Rat Atria. Front Pharmacol. 2016;7:45 pubmed publisher
western blot; rat; fig 8	Fornai M, Pellegrini C, Antonioli L, Segnani C, Ippolito C, Barocelli E, et al. Enteric Dysfunctions in Experimental Parkinson's Disease: Alterations of Excitatory Cholinergic Neurotransmission Regulating Colonic Motility in Rats. J Pharmacol Exp Ther. 2016;356:434-44 pubmed publisher
	Choi Y, Park J, Kim J, Lee S, Gong J, Jung Y, et al. Novel Characterization of Constipation Phenotypes in ICR Mice Orally Administrated with Polystyrene Microplastics. Int J Mol Sci. 2021;22: pubmed publisher
	Kim J, Choi Y, Lee S, Gong J, Lee Y, Sung J, et al. Antioxidant activity and laxative effects of tannin-enriched extract of Ecklonia cava in loperamide-induced constipation of SD rats. PLoS ONE. 2021;16:e0246363 pubmed publisher
	Gillet C, Kurth S, Kuenzel T. Muscarinic modulation of M and h currents in gerbil spherical bushy cells. PLoS ONE. 2020;15:e0226954 pubmed publisher
	Kim M, Yu H, Ju H, Shin J, Kim A, Lee J, et al. Induction of detrusor underactivity by extensive vascular endothelial damages of iliac arteries in a rat model and its pathophysiology in the genetic levels. Sci Rep. 2019;9:16328 pubmed publisher
	Kim J, Park J, Lee M, Choi J, Song B, Park J, et al. Constipation in Tg2576 mice model for Alzheimer's disease associated with dysregulation of mechanism involving the mAChR signaling pathway and ER stress response. PLoS ONE. 2019;14:e0215205 pubmed publisher
	Traini C, Del Popolo G, Faussone Pellegrini M, Guasti D, Catarinicchia S, Vannucchi M. Nerve sprouting and neurogenic inflammation characterize the neurogenic detrusor overactive bladder of patients no longer responsive to drug therapies. J Cell Mol Med. 2019;23:4076-4087 pubmed publisher
	Kim J, Go J, Lee H, Hong J, Hwang D. Spicatoside A in red Liriope platyphylla displays a laxative effect in a constipation rat model via regulating mAChRs and ER stress signaling. Int J Mol Med. 2019;43:185-198 pubmed publisher
	Lee W, Su C, Tain Y, Tsai C, Yu C, Chuang Y. Potential Orphan Drug Therapy of Intravesical Liposomal Onabotulinumtoxin-A for Ketamine-Induced Cystitis by Mucosal Protection and Anti-inflammation in a Rat Model. Sci Rep. 2018;8:5795 pubmed publisher
	Jang S, Yang D. The combination of Cassia obtusifolia L. and Foeniculum vulgare M. exhibits a laxative effect on loperamide-induced constipation of rats. PLoS ONE. 2018;13:e0195624 pubmed publisher
	Bertuzzi M, Ampatzis K. Spinal cholinergic interneurons differentially control motoneuron excitability and alter the locomotor network operational range. Sci Rep. 2018;8:1988 pubmed publisher
	Traini C, Fausssone Pellegrini M, Guasti D, Del Popolo G, Frizzi J, Serni S, et al. Adaptive changes of telocytes in the urinary bladder of patients affected by neurogenic detrusor overactivity. J Cell Mol Med. 2018;22:195-206 pubmed publisher
	Radu B, Osculati A, Suku E, Banciu A, Tsenov G, Merigo F, et al. All muscarinic acetylcholine receptors (M1-M5) are expressed in murine brain microvascular endothelium. Sci Rep. 2017;7:5083 pubmed publisher
	Booker S, Althof D, Degro C, Watanabe M, Kulik A, Vida I. Differential surface density and modulatory effects of presynaptic GABAB receptors in hippocampal cholecystokinin and parvalbumin basket cells. Brain Struct Funct. 2017;222:3677-3690 pubmed publisher
	Kim J, Go J, Sung J, Lee H, Yun W, Hong J, et al. Uridine stimulate laxative effect in the loperamide-induced constipation of SD rats through regulation of the mAChRs signaling pathway and mucin secretion. BMC Gastroenterol. 2017;17:21 pubmed publisher
	Kim J, Go J, Koh E, Song S, Sung J, Lee H, et al. Gallotannin-Enriched Extract Isolated from Galla Rhois May Be a Functional Candidate with Laxative Effects for Treatment of Loperamide-Induced Constipation of SD Rats. PLoS ONE. 2016;11:e0161144 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-CHRM2 Antibody (#AMR-002), (1:200).2. Anti-CHRM2 Antibody, preincubated with CHRM2 Blocking Peptide (#BLP-MR002).

image 2 :

Expression of Muscarinic acetylcholine receptor M2 in mouse parieto-temporal cortex sections - Immunohistochemical staining of mouse parieto-temporal cortex frozen sections (non-consecutive) using Anti-GIRK2 (Kir3.2) Antibody (#APC-006), (1:100) and Anti-CHRM2 Antibody (#AMR-002), (1:100). mAChR M2 staining (red) was dense in layer IV, with fibers climbing to layers II-III. Kir3.2 K+ channel staining (green) was dense in layers IV and I. Overlapping expression of Kir3.2 channel and mAChR M2 is seen in cortical layers.

image 3 :

Western blot analysisof rat brain membranes: - 1.Anti-CHRM2 Antibody (#AMR-002) (1:200).2. Anti-CHRM2 Antibody preincubated with the negative control antigen.

product information

CAT :

AMR-002

SKU :

AMR-002-CF_0.2 ml

Product Name :

Anti-CHRM2 Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P08172

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-MR002

Homology :

Chimpanzee, gorilla - identical; orangutan - 130/132 amino acid residues identical; pig - 122/132 amino acid residues identical; rat - 118/132 amino acid residues identical; mouse - 117/132 amino acid residues identical; dog - 122/132 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

3rd intracellular loop

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Human

Sequence :

SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid residues 225-356 of human M2
NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESS
NDSTSV
GST fusion protein with the sequence VANQDPVSPSLVQGRIVKPN

Product Page - Scientific background :

The action of the neurotransmitter acetylcholine is mediated through two types of receptors, the ionotropic nicotinic receptors and the metabotropic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-transmembrane G-protein coupled receptors. Five subtypes of muscarinic receptors have been cloned and are named M1-M5.1-2The muscarinic receptors are widely distributed throughout the body but are predominantly expressed in the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing, and motor control.1 They also participate in learning and memory processing.3-4The M2 receptor is considered to be the predominant muscarinic receptor subtype that is expressed in cardiac muscle.5The M2 and M4 receptors mediate Ca2+ channel inhibition and Kir3 K+ channel activation by directly binding the Gβγ subunit to the channel.6,7 Stimulation of the M2 receptor by acetylcholine in the heart results in activation of the Kir3.1/Kir3.4 channels causing a slowing in heart beat.7

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Muscarinic acetylcholine receptor M2, Cholinergic receptor muscarinic 2, mAChR M2

Short Description :

A Rabbit Polyclonal Antibody to Muscarinic Acetylcholine Receptor M2

Long Description :

Anti-CHRM2 Antibody (#AMR-002) is a highly specific antibody directed against an epitope of the human M2 muscarinic receptor. The antibody can be used in western blot, immunoprecipitation, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize M2 from mouse, rat, and human samples.

Negative Control :

BLP-MR002

Positive Control :

Synonyms :

Muscarinic acetylcholine receptor M2, Cholinergic receptor muscarinic 2, mAChR M2

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

CHRM2

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

IP IHC ICC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

1:100

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage