Anti-CHRM1 Antibody | Alomone Labs AMR-001 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-CHRM1 Antibody

catalog :

AMR-001

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry

more info or order :

Alomone Labs product webpage

citations: 4

Reference
Gillet C, Kurth S, Kuenzel T. Muscarinic modulation of M and h currents in gerbil spherical bushy cells. PLoS ONE. 2020;15:e0226954 pubmed publisher
Coppola J, Disney A. Most calbindin-immunoreactive neurons, but few calretinin-immunoreactive neurons, express the m1 acetylcholine receptor in the middle temporal visual area of the macaque monkey. Brain Behav. 2018;8:e01071 pubmed publisher
Damm M, Jensen T, Mahmood B, Lundh M, Poulsen S, Bindslev N, et al. Acetylcholine-related proteins in non-neoplastic appearing colonic mucosa from patients with colorectal neoplasia. Mol Carcinog. 2017;56:2223-2233 pubmed publisher
Calcutt N, Smith D, Frizzi K, Sabbir M, Chowdhury S, Mixcoatl Zecuatl T, et al. Selective antagonism of muscarinic receptors is neuroprotective in peripheral neuropathy. J Clin Invest. 2017;127:608-622 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-CHRM1 Antibody (#AMR-001), (1:200).2. Anti-CHRM1 Antibody, preincubated with CHRM1 Blocking Peptide (#BLP-MR001).

image 2 :

Expression of Muscarinic acetylcholine receptor M1 in rat striatum - Immunohistochemical staining of rat striatum (ST) using Anti-CHRM1 Antibody (#AMR-001). A. M1 mAChR appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV, red). C. Confocal merge of M1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).

image 3 :

Expression of Muscarinic acetylcholine receptor M1 in mouse striatum - Immunohistochemical staining of mouse striatum (ST) usingAnti-CHRM1 Antibody (#AMR-001). A. M1 mAChR appears in the striatum (green). B. Staining of interneurons with mouse anti-parvalbumin (PV red). C. Confocal merge ofM1 mAChR and PV demonstrates localization of PV expressing neurons in the striatal matrix; not in striatal patches (P).

product information

CAT :

AMR-001

SKU :

AMR-001-CF_0.2 ml

Product Name :

Anti-CHRM1 Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P11229

Applications :

IC IF IHC WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-MR001

Homology :

Macaca mulatta - 125/127 amino acid residues identical; mouse - 124/127 amino acid residues identical; pig - 124/127 amino acid residues identical; rat - 123/127 amino acid residues identical; gerbil - 123/127 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

3rd intracellular loop

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Human

Sequence :

corresponding to amino acid residues 227-353 of human M1
GSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRA
PRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKM
PMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKP
RGKEQLAKRK,
GST fusion protein with the sequence

Product Page - Scientific background :

The action of the neurotransmitter acetylcholine (ACh) is mediated through two types of receptors, the ionotrophic nicotinic receptors and the metabotrophic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-TM G-protein-coupled receptors. Five subtypes of muscarinic receptors have been cloned and named M1-M5.1-2The muscarinic receptors are widely distributed throughout the body, but are predominantly expressed within the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing and motor control.1 They also participate in learning and memory processing.3-4 The M1 receptors are the most abundant muscarinic subtype in the cortex and striatum. M1 receptors were also localized in the myenteric plexus where they function as autoreceptors to enhance the release of ACh from the nerves.5-6The M1, M3 and M5 receptors, which are coupled to Gq/11 proteins, can protect cells from undergoing apoptosis induced by DNA damage. The signaling mechanism that mediates this anti-apoptotic response is still poorly understood. However, it was recently reported that a poly-basic motif in the C-terminus tail of the M1, M3 and M5 receptors is an essential element for the anti-apoptotic response of those receptors.7

Applications may also work in :

IC IF IHC WB

Supplier :

Alomone Labs

Target :

Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1

Short Description :

A Rabbit Polyclonal Antibody to Muscarinic Acetylcholine Receptor M1

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against the 3rd intracellular loop of the human M1 muscarinic receptor. Anti-CHRM1 Antibody (#AMR-001) can be used in western blot analysis, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize M1 from human, mouse and rat samples.

Negative Control :

BLP-MR001

Positive Control :

Synonyms :

Cholinergic muscarinic receptor 1, Muscarinic acetylcholine receptor M1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

CHRM1

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

IHC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage