Anti-CLC-3 (CLCN3) Antibody | Alomone Labs ACL-001 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-CLC-3 (CLCN3) Antibody

catalog :

ACL-001

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Alomone Labs product webpage

citations: 8

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; human; loading ...; fig 6a immunohistochemistry - frozen section; mouse; loading ...; fig 5a western blot; mouse; loading ...; fig 5b	Shen K, Yang X, Liu G, Zhu G, Wang Z, Shi X, et al. The role of voltage-gated chloride channels in the epileptogenesis of temporal lobe epilepsy. EBioMedicine. 2021;70:103537 pubmed publisher
	Comini M, Sierra Marquez J, Guzman G, Franzen A, Willuweit A, Katona I, et al. CLC Anion/Proton Exchangers Regulate Secretory Vesicle Filling and Granule Exocytosis in Chromaffin Cells. J Neurosci. 2022;42:3080-3095 pubmed publisher
	Varela López E, del Valle Mondragon L, Castrejón Tellez V, Perez Torres I, Arenas A, Rojas F, et al. Role of the Transient Receptor Potential Vanilloid Type 1 (TRPV1) in the Regulation of Nitric Oxide Release in Wistar Rat Aorta. Oxid Med Cell Longev. 2021;2021:8531975 pubmed publisher
	Chen B, Wang S, Lu F, Lv X, Chen Y, Ma M, et al. SGK1 mediates hypotonic challenge-induced proliferation in basilar artery smooth muscle cells via promoting CREB signaling pathway. Eur J Pharmacol. 2021;898:173997 pubmed publisher
	Chen B, Huang C, Lv X, Zheng H, Zhang Y, Sun L, et al. SGK1 mediates the hypotonic protective effect against H2O2-induced apoptosis of rat basilar artery smooth muscle cells by inhibiting the FOXO3a/Bim signaling pathway. Acta Pharmacol Sin. 2020;41:1073-1084 pubmed publisher
	Ma M, Jin C, Huang X, Sun L, Zhou H, Wen X, et al. Clcn3 deficiency ameliorates high-fat diet-induced obesity and adipose tissue macrophage inflammation in mice. Acta Pharmacol Sin. 2019;: pubmed publisher
	Wu Z, Huo Q, Ren L, Dong F, Feng M, Wang Y, et al. Gluconate suppresses seizure activity in developing brains by inhibiting CLC-3 chloride channels. Mol Brain. 2019;12:50 pubmed publisher
	Pang R, Xie M, Yang J, Shen K, Chen X, Su Y, et al. Downregulation of ClC-3 in dorsal root ganglia neurons contributes to mechanical hypersensitivity following peripheral nerve injury. Neuropharmacology. 2016;110:181-189 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-CLC-3 (CLCN3) Antibody (#ACL-001), (1:200).2. Anti-CLC-3 (CLCN3) Antibody, preincubated with CLC-3/CLCN3 Blocking peptide (#BLP-CL001).

image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-CLC-3(CLCN3)Antibody (#ACL-001) (1:200).2.Anti-CLC-3 (CLCN3) Antibody preincubated with a control antigen.

image 3 :

Western blot analysisof membranes fromXenopusoocytes expressing CLC-3 CLC-4 and CLC-5 usingAnti-CLC-3(CLCN3)Antibody (#ACL-001) (kindly provided by Prof. Jordi Ehrenfeld University of Nice).

product information

CAT :

ACL-001

SKU :

ACL-001-CF_0.2 ml

Product Name :

Anti-CLC-3 (CLCN3) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P51792

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-CL001

Homology :

Mouse - identical; human, rabbit, guinea pig - 69/70 amino acid residues identical; Xenopus laevis - 61/70 amino acid residues identicalRat CLC-4 - 46/70 amino acid residues identical; rat CLC-5 - 49/70 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, near the C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rat

Sequence :

corresponding to amino acid residues 592-661 of rat CLC-3
SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPR,
GST fusion protein with the sequence

Product Page - Scientific background :

CLC-3 is a member of the voltage-dependent Cl- channel (CLC) family that includes nine known members in mammals. CLC channels can be classified as plasma membrane channels and intracellular organelle channels. The first group includes the CLC-1, CLC-2 CLC-Ka and CLCKb channels. The second group comprises the CLC-3, CLC-4, CLC-5, CLC-6 and CLC-7.CLC channels that function in the plasma membrane are involved in the stabilization of membrane potential and in transepithelial transport. The presumed function of the intracellular CLC channels is support of the acidification of the intraorganellar compartment. In this regard, recent reports indicate that ClC-4 and ClC-5 (and by inference ClC-3) can function as Cl-/H+ antiporters.1, 2The functional unit of the CLC channels is a dimer with each subunit forming a proper pore. Although the crystal structure of bacterial CLC channels was resolved, the topology of the CLC channels is complex and has not been fully elucidated. It is generally accepted that both the N- and C- terminus domains are intracellular while the number and configuration of the transmembrane domains vary greatly between different models. 1,2CLC-3 is widely distributed with prominent expression in tissues of neuroectoderm origin. In the brain, it is highly expressed in the hippocampus, olfactory bulb and olfactory cortex. The channel is also prominently expressed in aortic and coronary vascular smooth muscle cells, aortic endothelial cells and tracheal and alveolar epithelial cells.The physiological function of CLC-3 is not entirely clear, but it has been suggested that CLC-3 generates a shunt current of chloride for v-H+-ATPases, thereby aiding the acidification of endosomes and synaptic vesicles as well as lysosomes. Disruption of the ClC-3 gene in mice causes severe neuronal loss, leading to a complete loss of the hippocampus in adult mice. In addition, CLC-3 has been shown to have a critical role in the respiratory burst and phagocytosis of polymorphonuclear cells, a key cell type of innate host defense. 3,4

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

Short Description :

A Rabbit Polyclonal Antibody to CLC-3 (CLCN3) Channel

Long Description :

Anti-CLC-3 (CLCN3) Antibody (#ACL-001) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.

Negative Control :

BLP-CL001

Positive Control :

Synonyms :

Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

CLCN3

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

IHC ICC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage