product summary
Loading...
company name :
Alomone Labs
product type :
antibody
product name :
Anti-CLC-3 (CLCN3) Antibody
catalog :
ACL-001
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
NA
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 8
Published Application/Species/Sample/Dilution | Reference |
---|---|
| |
image
image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-CLC-3 (CLCN3) Antibody (#ACL-001), (1:200).2. Anti-CLC-3 (CLCN3) Antibody, preincubated with CLC-3/CLCN3 Blocking peptide (#BLP-CL001).
image 2 :

Western blot analysisof rat brain membranes: - 1.Anti-CLC-3(CLCN3)Antibody (#ACL-001) (1:200).2.Anti-CLC-3 (CLCN3) Antibody preincubated with a control antigen.
image 3 :

Western blot analysisof membranes fromXenopusoocytes expressing CLC-3 CLC-4 and CLC-5 usingAnti-CLC-3(CLCN3)Antibody (#ACL-001) (kindly provided by Prof. Jordi Ehrenfeld University of Nice).
product information
CAT :
ACL-001
SKU :
ACL-001-CF_0.2 ml
Product Name :
Anti-CLC-3 (CLCN3) Antibody
Group Type :
Antibodies
Product Type :
Antibodies
Clonality :
Polyclonal
Accession :
P51792
Applications :
IC IF IHC IP WB
Reactivity :
Human Rat Mouse
Host :
Rabbit
Blocking Peptide :
BLP-CL001
Homology :
Mouse - identical; human, rabbit, guinea pig - 69/70 amino acid residues identical; Xenopus laevis - 61/70 amino acid residues identicalRat CLC-4 - 46/70 amino acid residues identical; rat CLC-5 - 49/70 amino acid residues identical
Formulation :
PBS pH7.4
isotype :
Rabbit IgG
Peptide confirmation :
Confirmed by DNA sequence and SDS-PAGE
Reconstitution :
0.2 ml double distilled water (DDW).
Antibody Concentration After Reconstitut ... :
1 mg/ml
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Preservative :
No Preservative
Immunogen Location :
Intracellular, near the C-terminus
Label :
Unconjugated
Storage Before Reconstitution :
The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C
Shipping and storage :
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C
immunogen source species :
Rat
Sequence :
corresponding to amino acid residues 592-661 of rat CLC-3
SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPR,
GST fusion protein with the sequence
SLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPR,
GST fusion protein with the sequence
Product Page - Scientific background :
CLC-3 is a member of the voltage-dependent Cl- channel (CLC) family that includes nine known members in mammals. CLC channels can be classified as plasma membrane channels and intracellular organelle channels. The first group includes the CLC-1, CLC-2 CLC-Ka and CLCKb channels. The second group comprises the CLC-3, CLC-4, CLC-5, CLC-6 and CLC-7.CLC channels that function in the plasma membrane are involved in the stabilization of membrane potential and in transepithelial transport. The presumed function of the intracellular CLC channels is support of the acidification of the intraorganellar compartment. In this regard, recent reports indicate that ClC-4 and ClC-5 (and by inference ClC-3) can function as Cl-/H+ antiporters.1, 2The functional unit of the CLC channels is a dimer with each subunit forming a proper pore. Although the crystal structure of bacterial CLC channels was resolved, the topology of the CLC channels is complex and has not been fully elucidated. It is generally accepted that both the N- and C- terminus domains are intracellular while the number and configuration of the transmembrane domains vary greatly between different models. 1,2CLC-3 is widely distributed with prominent expression in tissues of neuroectoderm origin. In the brain, it is highly expressed in the hippocampus, olfactory bulb and olfactory cortex. The channel is also prominently expressed in aortic and coronary vascular smooth muscle cells, aortic endothelial cells and tracheal and alveolar epithelial cells.The physiological function of CLC-3 is not entirely clear, but it has been suggested that CLC-3 generates a shunt current of chloride for v-H+-ATPases, thereby aiding the acidification of endosomes and synaptic vesicles as well as lysosomes. Disruption of the ClC-3 gene in mice causes severe neuronal loss, leading to a complete loss of the hippocampus in adult mice. In addition, CLC-3 has been shown to have a critical role in the respiratory burst and phagocytosis of polymorphonuclear cells, a key cell type of innate host defense. 3,4
Applications may also work in :
IC IF IHC IP WB
Supplier :
Alomone Labs
Target :
Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
Short Description :
A Rabbit Polyclonal Antibody to CLC-3 (CLCN3) Channel
Long Description :
Anti-CLC-3 (CLCN3) Antibody (#ACL-001) is a highly specific antibody directed against an epitope of the rat protein. The antibody can be used in western blot and immunohistochemistry applications. It has been designed to recognize CLC-3 from rat, mouse, and human samples.
Negative Control :
BLP-CL001
Positive Control :
NA
Synonyms :
Chloride channel 3, Chloride transporter ClC-3, H+/Cl- exchange transporter 3
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Applications key :
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Specifictiy :
CLCN3
Form :
Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.
Comment :
Contact Alomone Labs for technical support and product customization
Species reactivity key :
H- Human, M- Mouse, R- Rat
Is Toxin :
No
Purity :
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.
UNSPSC :
41116161
KO-Validated :
yes
Cited Application :
IHC ICC
Clone :
NA
Standard quality control of each lot :
Western blot analysis
Antigen preadsorption control :
3 µg fusion protein per 1 µg antibody
Application Dilutions: Immunohistochemis ... :
Contact Alomone for information
Application Dilutions: Western blot wb :
1:200
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments