Anti-CaV1.2a (CACNA1C) Antibody | Alomone Labs ACC-013 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-CaV1.2a (CACNA1C) Antibody

catalog :

ACC-013

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, rat, domestic rabbit

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 7

Published Application/Species/Sample/Dilution	Reference
western blot; rat; loading ...; fig 3b	Kim T, Terentyeva R, Roder K, Li W, Liu M, Greener I, et al. SK channel enhancers attenuate Ca2+-dependent arrhythmia in hypertrophic hearts by regulating mito-ROS-dependent oxidation and activity of RyR. Cardiovasc Res. 2017;113:343-353 pubmed publisher
western blot; human; 1:100; fig s2	Mannhardt I, Breckwoldt K, Letuffe Brenière D, Schaaf S, Schulz H, Neuber C, et al. Human Engineered Heart Tissue: Analysis of Contractile Force. Stem Cell Reports. 2016;7:29-42 pubmed publisher
	Poulet C, Sanchez Alonso J, Swiatlowska P, Mouy F, Lucarelli C, Alvarez Laviada A, et al. Junctophilin-2 tethers T-tubules and recruits functional L-type calcium channels to lipid rafts in adult cardiomyocytes. Cardiovasc Res. 2021;117:149-161 pubmed publisher
	Morinaga A, Ito J, Niimi T, Maturana A. RBM20 Regulates CaV1.2 Surface Expression by Promoting Exon 9* Inclusion of CACNA1C in Neonatal Rat Cardiomyocytes. Int J Mol Sci. 2019;20: pubmed publisher
	Bi C, Tham D, Perronnet C, Joshi B, Nabi I, Moukhles H. The Oxidative Stress-Induced Increase in the Membrane Expression of the Water-Permeable Channel Aquaporin-4 in Astrocytes Is Regulated by Caveolin-1 Phosphorylation. Front Cell Neurosci. 2017;11:412 pubmed publisher
	Pluteanu F, Nikonova Y, Holzapfel A, Herzog B, Scherer A, Preisenberger J, et al. Progressive impairment of atrial myocyte function during left ventricular hypertrophy and heart failure. J Mol Cell Cardiol. 2018;114:253-263 pubmed publisher
	Raifman T, Kumar P, Haase H, Klussmann E, Dascal N, Weiss S. Protein kinase C enhances plasma membrane expression of cardiac L-type calcium channel, CaV1.2. Channels (Austin). 2017;11:604-615 pubmed publisher

image

image 1 :

Western blot analysis of rat heart membranes: - 1. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013), (1:200). 2. Anti-CaV1.2a (CACNA1C) Antibody, preincubated with Cav1.2a/CACNA1C Blocking Peptide (#BLP-CC013).

image 2 :

Expression of CaV1.2a in rat heart - Immunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the antibody was pre-incubated with the control peptide antigen, staining was blocked (B).

image 3 :

Western blot analysisof rat heart membranes: - 1.Anti-CaV1.2a(CACNA1C)Antibody (#ACC-013) (1:200).2. Anti-CaV1.2a (CACNA1C) Antibody preincubated with the control peptideantigen.

product information

CAT :

ACC-013

SKU :

ACC-013-CF_0.2 ml

Product Name :

Anti-CaV1.2a (CACNA1C) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P15381

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-CC013

Homology :

Rat, guinea pig - 31/46 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, N-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Rabbit

Sequence :

corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine
MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLN
HFYISPG,
GST fusion protein with the sequence

Product Page - Scientific background :

All L-type calcium channels are encoded by one of the CaV1 channel genes. These channels play a major role as a Ca2+ entry pathway in skeletal, cardiac and smooth muscles as well as in neurons, endocrine cells and possibly in non-excitable cells such as hematopoetic and epithelial cells. All CaV1 channels are influenced by dihydropyridines (DHP) and are also referred to as DHP receptors.While the CaV1.1 and CaV1.4 isoforms are expressed in restricted tissues (skeletal muscle and retina, respectively), the expression of CaV1.2 is ubiquitous and CaV1.3 channels are found in the heart, brain and pancreas. Several peptidyl toxins are described that are specific L-type channel blockers, but so far no selective blocker for one of the CaV1 isoforms have been described. These include the Mamba toxins Calcicludine (#SPC-650), Calciseptine (#C-500) and FS-2 (#F-700).There are two splice variants to the CaV1.2 channel designated CaV1.2a and CaV1.2b. The expression of the CaV1.2b variant is restricted to smooth muscle while CaV1.2a is specifically expressed in cardiac muscle.

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.

Short Description :

A Rabbit Polyclonal Antibody to CaV1.2a (CACNA1C) Channel

Long Description :

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rabbit CaV1.2a channel. Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013) can be used in western blot, immunohistochemistry and immunocytochemistry applications. It has been designed to recognize CaV1.2a from mouse, rat and human samples.

Negative Control :

BLP-CC013

Positive Control :

Synonyms :

Cardiac type α1C, Voltage-dependent L-type calcium channel subunit alpha-1C.

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

CACNA1C

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

Cited Application :

IHC ICC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage