domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 10
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 10
Western blot analysis of rat brain membranes: - 1. Anti-KV1.1 (KCNA1) Antibody (#APC-009), (1:200).2. Anti-KV1.1 (KCNA1) Antibody, preincubated with Kv1.1/KCNA1 Blocking Peptide (#BLP-PC009).
GST fusion protein with the sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTTADQNCVNKSKLLTDV corresponding to amino acid residues 416-495 of mouse KV1.1 (AccessionP16388). Intracellular C-terminus.
Cell surface detection of TREM2 in live intact mouse J774 macrophage cells: - ___ Cells.___ Cells + goat-anti-rabbit-FITC.___ Cells +Anti-TREM2 (extracellular) Antibody (#ANR-018) (2.5 g) + goat-anti-rabbit-FITC.
quantity:
price:
to the supplier
domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunocytochemistry
citations: 5
reactivity: human, mouse, rat
application: western blot, immunocytochemistry
citations: 5
Western blot analysis of rat brain lysate (lanes 1 and 3) and mouse brain lysate (lanes 2 and 4): - 1,2. Anti-KV1.1 (KCNA1) (extracellular) Antibody (#APC-161), (1:200).3,4. Anti-KV1.1 (KCNA1) (extracellular) Antibody, preincubated with Kv1.1/KCNA1 (extracellular) Blocking Peptide (#BLP-PC161).
Western blot analysis of human MCF-7 breast adenocarcinoma cell lysate: - 1.Anti-KV1.1 (KCNA1) (extracellular) Antibody (#APC-161) (1:200).2. Anti-KV1.1 (KCNA1) (extracellular) Antibody preincubated with the negative control antigen.
Expression of KV1.1 in rat PC12 cells - Cell surface detection of KV1.1 in live intact rat PC12 pheochromocytoma cells. A. Extracellular staining of cells withAnti-KV1.1 (KCNA1) (extracellular) Antibody (#APC-161) (1:50) followed by goat anti-rabbit-AlexaFluor-594 secondary antibody (red). B. Live view of the cells. C. Merge of A and B.
quantity:
price:
to the supplier
domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry
citations: 1
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry
citations: 1
Western blot analysis of Recombinant human Neurotrophin-4 (NT-4) protein (#N-270), (10 ng): - 1. Anti-Neurotrophin 4 (NT-4) Antibody (#ANT-004), (1:200).2. Anti-Neurotrophin 4 (NT-4) Antibody, preincubated with Neurotrophin 4/NT-4 Blocking Peptide (#BLP-NT004).
Expression of Neurotrophin 4 in mouse spinal cord - Immunohistochemical staining of mouse spinal cord using Anti-Neurotrophin 4 (NT-4) Antibody (#ANT-004). The spinal ventral horn (VH) was very lightly stained. However, in the perimeter of the white matter (WM) there were NT-4 immunoreactive cells with a small soma (triangles) and some had a stained process (arrows).
Western blot analysisof Recombinant human Neurotrophin-4 (NT-4) protein (#N-270) (10 ng): - 1.Anti-Neurotrophin 4 (NT-4) Antibody(#ANT-004) (1:200).2. Anti-Neurotrophin 4 (NT-4) Antibody preincubated with the negative control antigen.
quantity:
price:
to the supplier
domestic rabbit polyclonal (NA)
reactivity: mouse, rat
conjugate: ATTO 594
application: immunohistochemistry, immunocytochemistry
reactivity: mouse, rat
conjugate: ATTO 594
application: immunohistochemistry, immunocytochemistry
Multiplex staining of KV1.2 and KV1.1 in mouse cerebellum - Immunohistochemical staining of mouse perfusion-fixed frozen brain sections using Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:300) and Anti-KV1.1 (KCNA1) (extracellular)-ATTO Fluor-594 Antibody (#APC-161-AR), (1:100). A. KV1.2 staining, followed by donkey-anti-rabbit-Cy2 (green). B. KV1.1 staining (red). C. Merge of the two images suggests considerable co-localization in the pinceau structures (up-pointing arrows). KV1.1 also appears in blood vessels (down-pointing arrows), where no KV1.2 expression is observed.
Expression of KV1.1 in rat PC12 cells - Cell surface detection ofKV1.1 in live intact rat PC12 pheochromocytoma cells. A. Extracellular staining of cells withAnti-KV1.1 (KCNA1) (extracellular)-ATTO-594 Antibody (#APC-161-AR) (1:25) (red). B. Live view of the cells. C. Merge of A and B.
Immuno-colocalization of KV1.2 and KV1.1 in mouse cerebellum - Immunohistochemical staining of mouse perfusion-fixed frozen brain sections usingAnti-KV1.2 (KCNA2) Antibody(#APC-010) (1:300) andAnti-KV1.1 (KCNA1) (extracellular)-ATTO-594 Antibody(#APC-161-AR) (1:100). A. KV1.2 staining followed by donkey-anti-rabbit-Cy2 (green). B. KV1.1 staining (red). C. Merge of the two images suggests considerable co-localization in the pinceau structures (up-pointing arrows). KV1.1 also appears in blood vessels (down-pointing arrows) where no KV1.2 expression is observed.
quantity:
price:
to the supplier