Labome logo
home > Alomone Labs > Alomone Labs Kcnh2 antibody
Anti-KCNH2 (HERG) Antibody
Alomone Labs
catalog: APC-062
domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 9

Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells: - 1. Anti-KCNH2 (HERG) Antibody (#APC-062), (1:400).2. Anti-KCNH2 (HERG) Antibody, preincubated with KCNH2/HERG Blocking Peptide (#BLP-PC062).

GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS corresponding to amino acid residues 1106-1159 of humanKV11.1 (HERG) (AccessionQ12809). Intracellular C-terminus.

Expression of KV11.1 (HERG) in HEK-293 transfectedcells - Immunocytochemical staining of fixed and permeabilized KV11.1 transfectedHEK-293 cells. Cells were stained withAnti-KCNH2 (HERG) Antibody(#APC-062) followed bygoat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the KV11.1. Arrows indicate cells that do not expressthe channel.
quantity:
price:
to the supplier
Anti-KCNH2 (erg1) Antibody
Alomone Labs
catalog: APC-016
domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 9

Western blot analysis of HEK 293 cell lysate, stably expressing HERG channels: - 1. Anti-KCNH2 (erg1) Antibody (1:200).2. Anti-KCNH2 (erg1) Antibody, preincubated with KCNH2/erg1 Blocking Peptide (#BLP-PC016).

Peptide (CY)EEL PAGAP ELPQD GPT corresponding to residues 1122-1137 of rat KV11.1 (erg1) (AccessionO08962). Intracellular C-terminal part.

Western blot analysisof HEK 293 cell lysate stably expressing HERG channels: - 1.Anti-KCNH2(erg1) Antibody(1:200).2. Anti-KCNH2(erg1) Antibody preincubated with the negative control antigen.
quantity:
price:
to the supplier
Anti-KCNH2 (HERG) (extracellular) Antibody
Alomone Labs
catalog: APC-109
domestic rabbit polyclonal (NA)
reactivity: human, mouse
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 3

Western blot analysis of KV11.1 (HERG)-transfected HEK-293 cells: - 1. Anti-KCNH2 (HERG) (extracellular) Antibody (#APC-109), (1:200).2. Anti-KCNH2 (HERG) (extracellular) Antibody, preincubated with KCNH2/HERG (extracellular) Blocking Peptide (#BLP-PC109).

Expression of KV11.1 (HERG) in rat heart - Immunohistochemical staining of rat heart using Anti-KCNH2 (HERG) (extracellular) Antibody (#APC-109). A. Transversal section of the atrium wall; note that arterial smooth muscle fibers were not stained (green arrow). B. Longitudinal section of the myocardium. C. Section showing myocardium and endocardium (red arrow). DAB product is brown and the counterstain is cresyl violet.
quantity:
price:
to the supplier
Anti-KCNH2 (HERG) (extracellular)-FITC Antibody
Alomone Labs
catalog: APC-109-F
domestic rabbit polyclonal (NA)
reactivity: human, mouse
conjugate: FITC
application: flow cytometry
citations: 1

Cell surface detection of KV11.1 (HERG) in live intact K562 (human chronic myelogenous leukemia) and Jurkat (human T cell leukemia) cells: Cell surface detection of KV11.1 (HERG) in live intact K562 (human chronic myelogenous leukemia) and Jurkat (human T cell leukemia) cells: Black line: Unstained cells.  Green line: Cells + Anti-KCNH2 (HERG) (extracellular)-FITC Antibody (#APC-109-F), (1:25).

Cell surface detection of CCR3 in live intact human Jurkat T cell leukemia cells: - ___Cells.___Cells + goat-anti-rabbit-Alexa-488.___Cells +Anti-Human CCR3 (extracellular) Antibody (#ACR-023) (5 g/1x106cells) + goat-anti-rabbit-Alexa-488.
quantity:
price:
to the supplier
 
Labome.com © 2024 All Rights Reserved
last updated:2025-05-26