domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - free floating section
citations: 21
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - free floating section
citations: 21

Western blot analysis of rat brain membranes: - 1. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004), (1:1000).2. Anti-Aquaporin 4 (AQP4) (249-323) Antibody, preincubated with the control fusion protein (BLP-QP004).

Western blot analysisof rat brain membranes: - 1.Anti-Aquaporin 4 (AQP4) (249-323)Antibody (#AQP-004)(1:1000).2.Anti-Aquaporin 4 (AQP4) (249-323) Antibody preincubated with the control fusion protein.

GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV corresponding to amino acid residues 249-323 of rat AQP4 (Accession P47863). Intracellular C-terminus.
quantity:
price:
to the supplier
domestic rabbit polyclonal (NA)
reactivity: mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry
citations: 11
reactivity: mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry
citations: 11

Western blot analysis of mouse (lanes 1 and 3) and rat (lanes 2 and 4) brain lysates: - 1,2. Anti-Aquaporin 4 (AQP4) (300-314) Antibody (#AQP-014), (1:200).3,4. Anti-Aquaporin 4 (AQP4) (300-314) Antibody, preincubated with Aquaporin 4/AQP4 (300-314) Blocking Peptide (#BLP-QP014).

Expression of Aquaporin 4 in rat brain - Immunohistochemical staining of rat brain using Anti-Aquaporin 4 (AQP4) (300-314) Antibody (#AQP-014), (1:200). A. Aquaporin 4 (green) is detected in blood vessels in layers 1-3 of rat neocortex. B. Astrocytic processes were stained using mouse anti glial fibrillary acidic protein (GFAP) (red) and DAPI (blue) was used to delineate the cortical layers. C. Merge of Aquaporin 4 and GFAP shows overlap along blood vessels (arrows) in agreement with the role of astrocytes and Aquaporin 4 in regulation of the blood-brain barrier.

Expression of Aquaporin 4 in rat brain - Immunohistochemical staining of rat brain usingAnti-Aquaporin 4 (AQP4) (300-314) Antibody (#AQP-014) (1:200). A. Aquaporin 4 (green) is detected in blood vessels in layers 1-3 of rat neocortex. B. Astrocytic processes were stained using mouse anti glial fibrillary acidic protein (GFAP) (red) and DAPI (blue) was used to delineate the cortical layers. C. Merge of Aquaporin 4 and GFAP shows overlap along blood vessels (arrows) in agreement with the role of astrocytes and Aquaporin 4 in regulation of the blood-brain barrier.
quantity:
price:
to the supplier
domestic rabbit polyclonal (NA)
reactivity: mouse, rat
conjugate: ATTO 594
application: immunohistochemistry, immunocytochemistry
citations: 1
reactivity: mouse, rat
conjugate: ATTO 594
application: immunohistochemistry, immunocytochemistry
citations: 1

Expression of Aquaporin 4 in rat and mouse brain - Immunohistochemical staining of Aquaporin 4 in rat and mouse brain free floating frozen sections using Anti-Aquaporin 4 (AQP4) (300-314)-ATTO Fluor-594 Antibody (#AQP-014-AR), (1:80). A. AQP4 staining (red) in rat hippocampal CA1 region appears in outlines of blood vessels (arrows). DAPI is used as the counterstain (blue) and stains the pyramidal layer (P). B. AQP4 staining (red) in mouse hippocampal dentate gyrus region appears also in outlines of blood vessels (arrows). DAPI is used as the counterstain (blue) and stains the granule layer (G).
quantity:
price:
to the supplier
guinea-pigs polyclonal (NA)
reactivity: mouse, rat
application: western blot, immunohistochemistry
reactivity: mouse, rat
application: western blot, immunohistochemistry

Western blot analysis of rat brain membranes (lanes 1 and 3) and mouse brain membranes (lanes 2 and 4): - 1, 2. Guinea Pig Anti-Aquaporin 4 (AQP4) (300-314) Antibody (#AQP-014-GP), (1:400).3, 4. Guinea Pig Anti-Aquaporin 4 (AQP4) (300-314) Antibody, preincubated with Aquaporin 4 (AQP4) (300-314) Blocking Peptide (#BLP-QP014).

Expression of Aquaporin 4 in mouse hippocampus. - Immunohistochemical staining of perfusion-fixed frozen mouse brain sections with Guinea Pig Anti-Aquaporin 4 (AQP4) (300-314) Antibody (#AQP-014-GP), (1:200), followed by goat anti-guinea pig - Alexa Fluor-594. A. Staining in the hippocampal CA1 region, showed immunoreactivity (red) in blood vessel outlines (arrows). B. Pre-incubation of the antibody with Aquaporin 4 (AQP4) (300-314) Blocking Peptide (#BLP-QP014), suppressed staining. Cell nuclei are stained with DAPI (blue). P = pyramidal layer.
quantity:
price:
to the supplier
