product summary
Loading...
company name :
Agrisera
product type :
antibody
product name :
Anti-Transthyretin 56-61, amyloid specific (mouse monoclonal)
catalog :
AS16 3113
quantity :
100 µg
price :
384 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
application :
western blot, ELISA, immunohistochemistry
more info or order :
product information
Catalog Number :
AS16 3113
Product Name :
Anti-Transthyretin 56-61, amyloid specific (mouse monoclonal)
Product Type :
Primary antibody
Host Species :
Mouse
Clonality :
Monoclonal
Size :
100 µg
List Price (EUR) :
384 USD
Product Description :
Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.
CrossReactivity :
Human Transthyretin Amyloids
Background :
Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.
Immunogen :
The epitope has been mapped to residue 56-61
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADD
TWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSY
WKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYS
TTAVVTNPKE
Recombinant protein corresponding to the Human wild type Transthyretin.
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADD
TWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSY
WKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYS
TTAVVTNPKE
Recombinant protein corresponding to the Human wild type Transthyretin.
Purity :
Affinity purified in PBS pH 7.4.
Uses :
ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
Application Summary :
ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)
Storage :
Store lyophilized/reconstituted at 4°C, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.
more info or order :
company information

Agrisera
Agrisera is a Swedish company specializing in polyclonal and monoclonal antibody production, offering primary and secondary antibodies off-the-shelf. Agrisera offers an extensive list of antibodies suitable for detection of plant and algal proteins in a wide range of research areas and applications. They are reactive in thousands of plant and algal species and cited in thousands of scientific articles. Agrisera was awarded as the Plant Science Antibody Supplier of the Year by CiteAB for the company with the most antibody citations for research related to plant science during 2018.
browse more products
questions and comments