antibody

Anti-Transthyretin 56-61, amyloid specific (mouse monoclonal)

AS16 3113

100 µg

384 USD

monoclonal

mouse

nonconjugated

western blot, ELISA, immunohistochemistry

Anti-Transthyretin 56-61, amyloid specific (mouse monoclonal)

Primary antibody

Mouse

Monoclonal

100 µg

384 USD

Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.

Human Transthyretin Amyloids

Transthyretin (TTR), formerly known as Prealbumin, is in vivo involved in the binding and transportation of the Thyroxin hormone and retinol-binding protein. Mutations in TTR are associated with familial amyloidotic polyneuropathy (FAP) which is a fatal disease characterized by amyloid depositions found in visceral organs including the heart, liver, and kidney. The wild type form of TTR is associated with a late onset amyloidosis denoted senile systemic amyloidosis, affecting around 10% of the population above 80 years of age with depositions mainly found in the heart.Monoclonal IgG1 antibody. Amyloid specific for human Transthyretin. Detects the C-terminal fragment 49-127 frequently formed in vivo.

The epitope has been mapped to residue 56-61
GPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADD
TWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSY
WKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYS
TTAVVTNPKE
Recombinant protein corresponding to the Human wild type Transthyretin.

Affinity purified in PBS pH 7.4.

ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)

ELISA (ELISA), Immunohistochemistry (IHC), Western blot (WB)

Store lyophilized/reconstituted at 4°C, Please remember to spin the tubes briefly prior to opening them to avoid any losses that might occur from material adhering to the cap or sides of the tube.