This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Addgene
product type :
cDNA
product name :
pCMV6-G2-ATP8-V5 (puromycin)
catalog :
86852
citations: 1
| Reference |
|---|
Boominathan A, Vanhoozer S, Basisty N, Powers K, Crampton A, Wang X, et al. Stable nuclear expression of ATP8 and ATP6 genes rescues a mtDNA Complex V null mutant. Nucleic Acids Res. 2016;44:9342-9357 pubmed
|
product information
Catalog Number :
86852
Product Name :
pCMV6-G2-ATP8-V5 (puromycin)
article :
| doi | 10.1093/nar/gkw756 |
| id | 23009 |
| pubmed_id | 27596602 |
bacterial resistance :
Ampicillin
cloning :
| backbone | pCMV6 | |
| backbone_mutation | ||
| backbone_origin | ||
| backbone_size | ||
| promoter | ||
| sequencing_primer_3 | ||
| sequencing_primer_5 | ||
| vector_types |
|
growth notes :
MPELILYVAITLSVAERLVGPGHACAEPSFRSSRCSAPL
CLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLL
SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
TSAISRDIDTA
ATP5G2 (G2) targeting sequence is:
CLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLL
SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
TSAISRDIDTA
ATP5G2 (G2) targeting sequence is:
growth strain :
mammalian expression of ATP8 with G2 mitochondrial targeting sequence and V5 tag
origin :
37
pi :
|
resistance markers :
| 3234 |
tags :
Unknown
terms :
| Puromycin |
company information
Addgene
490 Arsenal Way, Suite 100
Watertown, MA 02472
Watertown, MA 02472
info@addgene.org
https://www.addgene.org617.225.9000
headquarters: USA
questions and comments
