This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Addgene
product type :
cDNA
product name :
pETM33_IRF3_SMAD/FHA
catalog :
178479
citations: 1
product information
Catalog Number :
178479
Product Name :
pETM33_IRF3_SMAD/FHA
article :
| doi | 10.15252/msb.202110584 |
| id | 28223170 |
| pubmed_id | 35044719 |
bacterial resistance :
Kanamycin
cloning :
| backbone | pETM33 | |
| backbone_mutation | ||
| backbone_origin | ||
| backbone_size | 6017 | |
| promoter | ||
| sequencing_primer_3 | ||
| sequencing_primer_5 | ||
| vector_types |
|
growth notes :
mgSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYR
GRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGM
SLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHC
HTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVD
LITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKV
VPTCLRALVEMARVGGASSLENTVDLHisNSHPLSLTSD
QYKAYLQDLVEGMDFQGPGES.
Please visit https://www.biorxiv.org/content/10.1101/2021.04.13.439572v1 for bioRxv preprint. Growth in BL21 DE3 gold 37 C after induction with 1mM IPTG 4 hours 30 C. Insert:
GRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGM
SLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHC
HTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVD
LITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKV
VPTCLRALVEMARVGGASSLENTVDLHisNSHPLSLTSD
QYKAYLQDLVEGMDFQGPGES.
Please visit https://www.biorxiv.org/content/10.1101/2021.04.13.439572v1 for bioRxv preprint. Growth in BL21 DE3 gold 37 C after induction with 1mM IPTG 4 hours 30 C. Insert:
growth strain :
Bacterial expression of human domain with His-tag and GST tag
origin :
37
pi :
|
resistance markers :
| 5021 |
tags :
Unknown
company information
Addgene
490 Arsenal Way, Suite 100
Watertown, MA 02472
Watertown, MA 02472
info@addgene.org
https://www.addgene.org617.225.9000
headquarters: USA
questions and comments
