This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Addgene
product type :
cDNA
product name :
mCherry-7aa-cb5-pEGFP-C1
catalog :
177407
product information
Catalog Number :
177407
Product Name :
mCherry-7aa-cb5-pEGFP-C1
article :
| doi | |
| id | 28223012 |
| pubmed_id |
bacterial resistance :
Kanamycin
cloning :
| backbone | pEGFP-C1 | |
| backbone_mutation | ||
| backbone_origin | ||
| backbone_size | ||
| promoter | ||
| sequencing_primer_3 | ||
| sequencing_primer_5 | ||
| vector_types |
|
growth notes :
Transfection of this plasmid will express mCherry-fused to the N-terminus of Cb5 tail anchor sequence ITTVESNSSWWTNWVIPAISALVVALMYRLYMAED , which targets the cytoplasmic face of endoplasmic reticulum. There is a flexible, 7 aa linker SGLRSGK , between mCherry and Cb5.
growth strain :
To express mCherry fused to endoplasmic reticulum (ER) targeting sequence Cb5 . mCherry faces the cytosol.
origin :
37
pi :
|
plasmid copy :
See gene entry for cytochrome b5 [Rattus norvegicus] , See NCBI Reference Sequence: NP_071581.1. Here we have used only the C-terminal tail anchor sequence. mCherry sequence matches GenBank: AZP55984.1.
resistance markers :
| 4132 |
tags :
Unknown
terms :
| Neomycin (select with G418) |
company information
Addgene
490 Arsenal Way, Suite 100
Watertown, MA 02472
Watertown, MA 02472
info@addgene.org
https://www.addgene.org617.225.9000
headquarters: USA
questions and comments
