This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Addgene
product type :
cDNA
product name :
pHH0103 NEDD4 WW domain #3
catalog :
104210
citations: 1
product information
Catalog Number :
104210
Product Name :
pHH0103 NEDD4 WW domain #3
article :
| doi | |
| id | 28192177 |
| pubmed_id |
bacterial resistance :
Ampicillin
cloning :
| backbone | pHH0103 | |
| backbone_mutation | ||
| backbone_origin | ||
| backbone_size | ||
| promoter | ||
| sequencing_primer_3 | ||
| sequencing_primer_5 | ||
| vector_types |
|
growth notes :
Amino acid sequence: Linker - ENLYFQGRRASV(gagctc) and WW domain - EQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIP
growth strain :
Bacterial expression of WW domain #3 from NEDD4
origin :
37
pi :
|
resistance markers :
| 3390 |
| 507 |
tags :
Unknown
company information
Addgene
490 Arsenal Way, Suite 100
Watertown, MA 02472
Watertown, MA 02472
info@addgene.org
https://www.addgene.org617.225.9000
headquarters: USA
questions and comments
