This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NES polyclonal antibody
catalog :
PAB30771
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
PAB30771
product name :
NES polyclonal antibody
product description :
Rabbit polyclonal antibody raised against partial recombinant human NES.
isotype :
IgG
gene name :
NES
gene alias :
FLJ21841 Nbla00170
gene description :
nestin
immunogen :
Recombinant protein corresponding to human NES.
immunogen sequence protein sequence :
DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQA
SPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTRE
EVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSE
LP
SPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTRE
EVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSE
LP
protein accession :
P48681
form :
Liquid
recommend dilutions :
Immunofluorescence (1-4 ug/mL). Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000). Western Blot (1:100-1:250). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,IF
size :
100 uL
autodate :
2016-12-02
updatetime :
2016-12-02 10:27:49
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
