This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SLAMF6 polyclonal antibody
catalog :
PAB30281
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
product information
catalog id :
PAB30281
product name :
SLAMF6 polyclonal antibody
product description :
Rabbit polyclonal antibody raised against partial recombinant human SLAMF6.
isotype :
IgG
gene name :
SLAMF6
gene alias :
KALI KALIb Ly108 MGC104953 NTB-A NTBA SF2000
gene description :
SLAM family member 6
immunogen :
Recombinant protein corresponding to amino acids 152-224 of human SLAMF6.
immunogen sequence protein sequence :
TCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSE
QDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDT
QDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDT
protein accession :
Q96DU3
form :
Liquid
recommend dilutions :
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200). Western Blot (1:100 - 1:250). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
storage instruction :
Store at 4 C for short term storage. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P
size :
100 uL
autodate :
2016-10-28
updatetime :
2016-10-28 09:46:09
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
