This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CLEC4M polyclonal antibody
catalog :
PAB29924
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
product information
catalog id :
PAB29924
product name :
CLEC4M polyclonal antibody
product description :
Rabbit polyclonal antibody raised against synthetic peptide of human CLEC4M.
gene name :
CLEC4M
gene alias :
CD209L CD299 DC-SIGN2 DC-SIGNR DCSIGNR HP10347 L-SIGN LSIGN MGC129964 MGC47866
gene description :
C-type lectin domain family 4, member M
genbank accession :
NM_014257
immunogen :
A synthetic peptide corresponding to N-terminus of human CLEC4M.
immunogen sequence protein sequence :
LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAI
YQNLTQLKAAV
YQNLTQLKAAV
protein accession :
NP_055072;Q9H2X3
form :
Liquid
recommend dilutions :
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL). Western Blot (1.25 ug/mL). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS (2% sucrose, 0.09% sodium azide).
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P
size :
100 uL
autodate :
2016-07-01
updatetime :
2016-07-01 10:59:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
