This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MCM3 polyclonal antibody
catalog :
PAB29920
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
product information
catalog id :
PAB29920
product name :
MCM3 polyclonal antibody
product description :
Rabbit polyclonal antibody raised against partial synthetic protein of human MCM3.
isotype :
IgG
gene name :
MCM3
gene alias :
HCC5 MGC1157 P1-MCM3 P1.h RLFB
gene description :
minichromosome maintenance complex component 3
immunogen :
A synthetic peptide corresponding to amino acids 726-775 of human MCM3.
immunogen sequence protein sequence :
SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQ
VHTPKTADSQE
VHTPKTADSQE
protein accession :
P25205
form :
Liquid
recommend dilutions :
Immunohistochemistry (1:250). Western Blot (1:1000). The optimal working dilution should be determined by the end user.
storage buffer :
In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
storage instruction :
Store at 4 C for up to one week. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P
size :
100 uL
autodate :
2016-07-01
updatetime :
2016-07-01 10:31:21
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
