This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
NCAPH polyclonal antibody
catalog :
PAB28677
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry
product information
catalog id :
PAB28677
product name :
NCAPH polyclonal antibody
product description :
Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H.
isotype :
IgG
gene name :
NCAPH
gene alias :
BRRN1 CAP-H HCAP-H
gene description :
non-SMC condensin I complex, subunit H
immunogen :
Recombinant protein corresponding to amino acids of human NCAPH.
immunogen sequence protein sequence :
LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLK
APLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDK
FKKNDQVFDINAEVDESDCGDFPDGSLGDDFDANDEPDH
T
form :
Liquid
recommend dilutions :
Immunohistochemistry (1:50-1:200) . Western Blot (1:100-1:500) . The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
IHC,WB-Ce
size :
100 uL
autodate :
2014-04-03
updatetime :
2016-08-05 17:14:54
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098