This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PSMC4 polyclonal antibody
catalog :
PAB28661
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
PAB28661
product name :
PSMC4 polyclonal antibody
product description :
Rabbit polyclonal antibody raised against recombinant PSMC4.
isotype :
IgG
gene name :
PSMC4
gene alias :
MGC13687 MGC23214 MGC8570 MIP224 S6 TBP7
gene description :
proteasome (prosome, macropain) 26S subunit, ATPase, 4
immunogen :
Recombinant protein corresponding to amino acids of human PSMC4.
immunogen sequence protein sequence :
LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHA
QEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVR
ILSTIDRELLKPNASVALHKHSNA
QEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVR
ILSTIDRELLKPNASVALHKHSNA
form :
liquid
recommend dilutions :
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:200-1:500). Immunofluorescence (1-4 ug/ml). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB,WB-Ce,IHC-P,IF
size :
100 uL
autodate :
2014-02-27
updatetime :
2014-02-27 11:17:09
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
