This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
APOH polyclonal antibody
catalog :
PAB28473
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
product information
catalog id :
PAB28473
product name :
APOH polyclonal antibody
product description :
Rabbit polyclonal antibody raised against recombinant APOH
isotype :
IgG
gene name :
APOH
gene alias :
B2G1 BG
gene description :
apolipoprotein H (beta-2-glycoprotein I)
immunogen :
Recombinant protein corresponding to amino acids of human APOH
immunogen sequence protein sequence :
ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDG
YSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQ
GERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQC
IDGTIEVPKCFKEHSSLAFSKTDASDVK
YSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQ
GERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQC
IDGTIEVPKCFKEHSSLAFSKTDASDVK
protein accession :
P02749
form :
Liquid
recommend dilutions :
Immunohistochemistry(1:50-1:200). Western Blot(1:100-1:250). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P,WB-Tr
size :
100 uL
autodate :
2013-10-04
updatetime :
2013-10-04 14:29:56
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
