This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
GADD45B polyclonal antibody
catalog :
PAB22350
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry - paraffin section
product information
catalog id :
PAB22350
product name :
GADD45B polyclonal antibody
product description :
Rabbit polyclonal antibody raised against recombinant GADD45B.
isotype :
IgG
gene name :
GADD45B
gene alias :
DKFZp566B133 GADD45BETA MYD118
gene description :
growth arrest and DNA-damage-inducible, beta
immunogen :
Recombinant protein corresponding to amino acids of human GADD45B.
immunogen sequence protein sequence :
AVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLA
QLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEV
ASYCEESRGNNQWVPY
IDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLA
QLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEV
ASYCEESRGNNQWVPY
protein accession :
O75293
form :
Liquid
recommend dilutions :
Immunohistochemistry (1:20-1:50). The optimal working dilution should be determined by the end user.
storage buffer :
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
storage instruction :
Store at 4 C. For long term storage store at -20 C. Aliquot to avoid repeated freezing and thawing.
note :
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P
size :
100 uL
autodate :
2011-12-30
updatetime :
2016-04-26 12:07:24
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
